KEGG   Rattus norvegicus (rat): 688590
Entry
688590            CDS       T01003                                 

Gene name
Rundc3b
Definition
(RefSeq) RUN domain containing 3B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RUN
Other DBs
NCBI-GeneID: 688590
NCBI-ProteinID: NP_001040581
RGD: 1587590
Ensembl: ENSRNOG00000008463
UniProt: Q3B7K9
Position
4q12
AA seq 403 aa
MASRSLGGLSGSRGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFN
NFAAVLEQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAK
GRAWIRVALMEKHLSEYISTALRDFKTTRRFYEEGAIVLGEEANMLAGMLLGLNAIDFSF
CLKGEGLDGTFPAVIDYTPYLKFEQSSDSISSDEEELRTFGSSDSEGSTPENVGPPLILD
ENSWFNKCKRVRQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLE
KEQLEYIIVELQDQLKSYQSLDQLSAEVSLSQASLDPGHSQEGDGKQDSLNFIGEGKEDT
PSLLGLCGSLTSVASYKSLTSLKSNDCLASPTTEITSPGLTPS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcctcccggagcctggggggcctgagcgggagccgcggcggcggcaagaagagcctg
agcgcccgcaacgctgcggtggagaggaggaacctgatcaccgtgtgcagattttctgtg
aagaccctgattgatcggtcttgctttgaaacaattgatgattcttctcctgaatttaat
aactttgcagctgttctggaacaaattctaagtcaccggctgaaaggtcaagtaacctgg
tttggctatgaaagtcctcgtagcttctgggactacatcagagtggcttgccggaaagtt
tcacaaaactgtatctgtagtattgaaaatatggaaaatgtcagttcctccagagctaag
ggtagagcctggatcagagtagcactcatggaaaaacatttgtctgaatacatctctaca
gctttgagagacttcaaaacaaccaggaggttttatgaagaaggagcgattgtcctgggg
gaagaggcaaacatgcttgctggcatgctgctgggcctcaacgccattgacttcagcttc
tgcctaaagggagaaggattggatggcaccttccctgctgtgatagactatacaccatat
ttgaagtttgagcaaagttctgacagcatcagcagtgatgaggaagagctcaggacattc
gggagcagtgacagtgagggcagcacccctgagaacgtgggcccacctctaatcctggac
gagaacagctggttcaacaagtgcaagagagtaaggcagaagtaccagctcaccctggag
cagaagggttatcttgaagaactcttacggcttcgtgagaaccagctttctgaatctgtc
tctcagaataaaatcctacttcagaggatcgaagattctgacctggcccacaaactggag
aaagaacagttagaatatatcatcgtggagcttcaggaccagcttaaaagttaccaaagc
cttgaccagttatcagcagaagtcagcctttctcaggcctcattggatcccggccactca
caagaaggcgatggaaagcaagactcattgaatttcatcggtgaaggtaaagaagatact
ccctcacttcttggtctttgtgggtcactaacatcagtggcaagttacaagtccctaaca
agcctaaaatccaatgactgccttgcaagccccaccacggagataacaagcccaggcctg
actccatcctga

DBGET integrated database retrieval system