KEGG   Rattus norvegicus (rat): 688717Help
Entry
688717            CDS       T01003                                 

Gene name
Slirp
Definition
(RefSeq) SRA stem-loop interacting RNA binding protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 Nup35_RRM
Motif
Other DBs
NCBI-GeneID: 688717
NCBI-ProteinID: NP_001102977
RGD: 1585290
Ensembl: ENSRNOG00000012314
UniProt: D4A4W6
Position
6q31
AA seq 111 aa AA seqDB search
MAASAVKGLTALRSRTGRPIAFIRKIPWTAASSELREHFAQFGHVRRCTVPFDKETGFHR
GMGWVQFSSQEELQNALQEEHHIIDGVEIHVQPQKPKVLHGAQTSDEEKDF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctccgcggtaaaaggactaactgcgttgcgttcccgtactggtcggcctata
gcgtttattagaaaaattccttggaccgcggcatcgagtgagctaagagaacattttgct
cagtttggccatgtaagaaggtgcactgtaccttttgacaaagagactggctttcacaga
ggcatgggttgggttcagttttcttcacaggaagaacttcagaatgcactacaagaagaa
catcatattattgatggagtagaaatccatgttcaacctcaaaaaccaaaggttttgcac
ggggctcaaacatctgatgaagagaaagatttctga

DBGET integrated database retrieval system