KEGG   Rattus norvegicus (rat): 688737Help
Entry
688737            CDS       T01003                                 

Gene name
Gpr171
Definition
(RefSeq) G protein-coupled receptor 171
  KO
K08441  G protein-coupled receptor 171
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    688737 (Gpr171)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   BigLEN
    688737 (Gpr171)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 688737
NCBI-ProteinID: NP_001102980
RGD: 1585271
Ensembl: ENSRNOG00000025297
UniProt: D4A4Q2
Position
2q26
AA seq 326 aa AA seqDB search
MTNSSMFCPIYRDLEPFTYFFYLVYLIGIIGSCFATWAFIQKSTNHRCVSIYLINLLTAD
FLLTLALPVKIVVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLVHSC
KIYRIQEPGFAKMISAVVWLMVLLIMVPNMVIPIKNIKEKSNVGCMEFKREFGKNWHLLT
NFICVAIFLNFSAIILISNFLVIRQLYRNRDNANYPSVKSALLNILLVTASYIICFVPYH
AVRIPYTLSQTEVISDCSTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTETF
ASPQKMKAREEKPRRENDVQSTGSAC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagttccatgttctgcccaatttacagagatctagaaccatttacgtatttt
ttttatttagtttatctcattggaatcattgggagttgttttgcaacgtgggcttttata
cagaaaagcacaaatcacaggtgtgtgagcatatatttaattaacctgcttacagctgac
ttcctgctcactctggcattgccagtaaaaatcgttgttgacttgggtgtggcgccctgg
aaactaaggatattccactgccaagtgacagcctgcctcatctacatcaacatgtactta
tctattatcttcttagcctttgtcagcattgaccgctgtcttcagttagtacacagctgc
aagatataccgaatccaagaacctgggtttgccaaaatgatatcggccgtcgtgtggctc
atggtcctgcttataatggtgccgaacatggtgattcccatcaagaacatcaaagaaaaa
tctaatgtaggttgcatggagtttaaaagggagttcggaaaaaattggcacttgctaaca
aatttcatatgtgtggcaatatttttaaatttctcagccatcattctgatatccaacttc
cttgtaattagacaactctacagaaacagagacaacgcaaactacccaagcgtgaagtcg
gctctgctcaacattctcctggtgacagcgagttacatcatatgctttgttccttaccac
gctgttaggatcccatacaccctcagccagacagaggtgatatctgactgctcaactagg
attgctctcttcaaagccaaggaggccacactgctgctggctgtgtccaacctgtgcttt
gacccaattctgtactatcatctgtcgaaagcatttcgactgaaggtcactgagactttc
gcctcgcctcaaaagatgaaggctcgggaggaaaaaccgagacgtgagaatgacgtgcaa
agtacaggctctgcgtgttag

DBGET integrated database retrieval system