KEGG   Rattus norvegicus (rat): 688777
Entry
688777            CDS       T01003                                 

Gene name
Grpel2
Definition
(RefSeq) GrpE-like 2, mitochondrial
  KO
K03687  molecular chaperone GrpE
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    688777 (Grpel2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    688777 (Grpel2)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP24
   688777 (Grpel2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    688777 (Grpel2)
SSDB
Motif
Pfam: GrpE GOLGA2L5
Other DBs
NCBI-GeneID: 688777
NCBI-ProteinID: NP_001102983
RGD: 1585231
Ensembl: ENSRNOG00000042682
UniProt: D4A676
Position
18
AA seq 224 aa
MAARSLWAVQRLQRLLASGAVSESRGWLHPFSTATQRTAGEDCSSEDPPDGLGPSLAEQA
LRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILE
KTAECFSDGAEPQDHKLTLEKVFQGLSLLEAKLKSVFTKHGLEKMAPIGDKYDPHEHELI
CHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVAVESQRRL
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcggcgcgttcgctgtgggcggtgcagcgtctgcagcgcctactggcctccggggct
gtgtcagagagcaggggatggctacaccctttcagcactgccacccagagaactgctggg
gaagactgcagttctgaggaccctcctgatggacttggtccctcccttgctgaacaggcc
ttaaggctaaaagctgttaaactggaaaaagaagtccaggatttaacactgagataccag
agagccgtcgctgactgtgaaaacataaggagacggacccagagatgtgtggaagatgcg
aagatatttgggatccagagcttctgtaaggacctcgtggaggtagcagacattttggag
aagactgccgagtgcttttcagacggagctgaacctcaggaccacaagcttactctggaa
aaagtcttccaagggctgtccctgttagaagcaaagctgaaaagtgtgtttaccaagcat
ggcctagagaaaatggcacccatcggtgacaaatacgaccctcatgagcatgaactcatc
tgccacatgccagcaggtgttggggtgcagcctggcaccgtggcattagttcggcaggat
ggctacaaacttcatggccgcaccattagacttgcacaagtggaagtggcagtagagtct
caaagaaggctctga

DBGET integrated database retrieval system