KEGG   Rattus norvegicus (rat): 688819
Entry
688819            CDS       T01003                                 

Gene name
Cib4
Definition
(RefSeq) calcium and integrin binding family member 4
  KO
K23839  calcium and integrin-binding protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    688819 (Cib4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   688819 (Cib4)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 LXG EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 688819
NCBI-ProteinID: XP_001068424
RGD: 1584147
Ensembl: ENSRNOG00000009898
UniProt: D3ZX64
Position
6q14
AA seq 185 aa
MGQCLRYQMQWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKHYKEATLTMDQVSSLPA
LRVNPFRDRICRVFSHDDVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQKIVLRLLKSDDVSEDLLQDVTHHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
NT seq 558 nt   +upstreamnt  +downstreamnt
atgggacagtgtttgaggtaccagatgcagtgggaggacctggaagagtaccaggctctg
accttcttgacgagaaacgagattctgtgcatccacgacaccttcctgaagctctgcccc
ccgggcaagcactataaggaggccacactgaccatggaccaggtcagctcccttccggct
ctaagggtcaaccctttcagagaccgcatctgcagggtcttctcccacgatgacgtgttc
tcctttgaagatgtgctgggtatggcatctgtcttcagtgaacaggcctgccccagcctg
aagattgaatatgcctttcgcatctatgattttaacgagaacggcttcatcgacgaggaa
gacctccagaagatagtactaagactactgaaaagcgatgatgtgtccgaggacctgctg
caggacgtcactcaccacgtcctgagtgagtcagatctggacaatgacaacatgctttcc
ttctccgagttcgaacatgcaatggccaaatctccggatttcatgaactcctttcggatt
cacttctgggggtgctga

DBGET integrated database retrieval system