KEGG   Rattus norvegicus (rat): 688887
Entry
688887            CDS       T01003                                 

Gene name
Cfhr2
Definition
(RefSeq) complement factor H-related protein 4 isoform X1
  KO
K23816  complement factor H-related protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    688887 (Cfhr2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 688887
NCBI-ProteinID: XP_001068704
RGD: 1584079
Position
13
AA seq 693 aa
MRFCILLLFASIFLTSWLSTAKGEVEVKCLAPHIPNGNYTPHRINYTAEDEIQYECTDGF
YPTTQGTVAKCTSTGWIPAPRCSLEPCDFPQFKNGYLYHENIRRSYFPVPIGKEFSYYCD
NGFLTPSGSYWDYLRCTRQGWEPEVPCLKTCLKSDIEIENGFLSQSDSKYLQNKKAQYMC
KQGYVTADGETSGSITCLENGWSAQPSCLKSCDVPVFENSVTKNNSTWFKLNDKLDYECH
IGYKNKYKHTKSSITCTYEGWSDEPTCYDSTKICGPPPPIENGDITSFPLPVYIPPSSVD
YQCQYLYQMQGNKTIICINGDWSEPPKCLRMACKPPDIPNGIYSPQRVTYTAQDEIKFEC
KDGFYSATQETVAKCTSTGWIPAPKCMKPCEFPQIKNGGLYHERRRRPYFPVPIGNEYSY
YCDNGFLTPSLSYWDYLRCTEKGWEPEVPCLKQCVFHYVENGESSYWQRKYVEEQAVKVQ
CYNGYSLPNGQDTITCTENGWSPPAKCIKSCDVPIFENAGTNNDSTWFKLNDKINYECHV
GYVNKHKHTKGSITCHHDGWSDIPSCYDSTKICGPPPPIANGDTTSFPLPVYIPPSSVEY
QCQSLYQLQGNKTIICINGEWSDPPKCLHPCIISIEIMRKHNITFRTEENQRLYYQSGEM
QEFKCKNGHHLATTQPLITICINGHLNYPVCTK
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaggttctgtatcctattgctctttgccagtatcttcctaacctcgtggctctctact
gccaaaggtgaagtagaagtgaaatgcttagctcctcatattccaaatggtaactacaca
cctcacaggattaactacacagctgaagatgaaatacagtatgaatgtacagatggcttc
taccctacaacccagggaactgttgcaaagtgtacaagtactggatggattcctgctcca
agatgtagtttggaaccttgtgattttccacaattcaaaaatggatatttatatcatgaa
aacatacgtagatcttacttcccagtacctataggaaaggagttcagctattactgtgac
aatgggtttttgacaccttcaggatcatactgggactaccttcgttgtacaagacaaggg
tgggagcctgaagtcccatgcctcaagacatgtttaaagtcagatattgaaattgagaat
ggatttctttctcaatctgattctaaatatcttcaaaataagaaagcacagtatatgtgt
aaacagggatatgtgacagcagatggagaaacatctggatcaattacctgcctagaaaat
ggatggtcagctcaaccctcatgccttaagtcgtgtgatgtgcctgtgtttgagaattct
gtaactaagaataatagcacatggtttaaactcaatgacaaattagactatgaatgtcac
attggatataaaaacaagtataaacataccaaaagctccataacttgtacttatgaagga
tggtctgatgaacccacatgttatgattcaacaaagatatgtgggcctcctccacctatt
gagaatggagacatcacatccttcccactaccagtatacataccaccatcatcagttgat
tatcagtgccagtatttgtatcaaatgcagggcaacaaaacaatcatatgtataaatgga
gactggtcagagccaccaaaatgtttacgaatggcatgcaaacctcctgatattccaaat
ggtatctactcacctcaaagggttacctacacagctcaagatgaaataaaatttgaatgt
aaagacggtttctactctgcaacccaggaaactgtagcaaagtgtacaagtactggatgg
atccctgctccaaaatgtatgaaaccttgtgagtttccacagattaaaaatggaggtcta
tatcatgagaggagacgaagaccctacttcccagtacctataggaaatgagtacagctat
tactgtgacaatgggtttttgacaccttctctgtcatactgggactaccttcgttgcaca
gaaaaagggtgggagcctgaagtcccgtgcctcaaacaatgtgttttccattatgtggag
aatggggaatcttcatactggcaaagaaaatatgtagaggaacaggctgtaaaagtccag
tgttacaatggctatagtcttccaaatggtcaagacacgattacatgtacagagaatggc
tggtcccctcctgccaaatgcattaaatcgtgtgatgtgcctatatttgagaatgctgga
actaacaatgatagcacttggtttaaactcaatgacaaaataaactatgaatgtcatgtt
ggatatgtgaacaaacataaacataccaaaggctctataacttgtcatcatgatggatgg
tctgacataccctcatgttatgattcaacaaagatttgtgggcctcctccacctattgcc
aatggagacaccacatccttcccactaccagtatacataccaccatcatcagttgaatat
cagtgccagtctttataccaactgcaaggcaacaagacaataatatgtataaatggagag
tggtctgatccaccaaaatgtttacatccatgtataatatcaatagaaattatgaggaag
cataacataactttcagaacggaagaaaaccaaaggctgtattaccaatcaggggagatg
caagaatttaagtgtaaaaatggacatcatctggcaacaactcaaccgttgattacaata
tgcattaatggtcacctcaattaccctgtttgcacaaaataa

DBGET integrated database retrieval system