KEGG   Rattus norvegicus (rat): 688990Help
Entry
688990            CDS       T01003                                 

Gene name
Trnp1
Definition
(RefSeq) TMF1-regulated nuclear protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin
Motif
Other DBs
NCBI-GeneID: 688990
NCBI-ProteinID: XP_001069068
RGD: 1582917
Ensembl: ENSRNOG00000055936
UniProt: A0A0G2K0Y1
Position
5q36
AA seq 225 aa AA seqDB search
MPGCRISACGPGAQEGTAEPGSPPPPPREPLPSLQPPSSSPTSTPTSTQSPQLPEAAETP
VEGQELQRWRQGASGGSGGASPAGIGGAGAAAGAGGRALELAEARRRLLEVEGRRRLVSE
LESRVLQLHRVFLAAELRLAHRAESLSRLSGGVAQAELYLAAHGSRLKKGARRGRRGRPP
ALLASALGLGSCVPWGAGRLRRGQGPEPDSPFRRSPPRGPASPQR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctgccgcatcagcgcctgcggcccaggggcccaggaggggaccgcagaacca
gggtcgcccccgccgccaccccgggagcccctgccgtccctccagcccccttcctcatcg
ccgacctcgactccgacctccactcagtcaccgcagttacccgaagcggccgagacaccc
gtggaggggcaggagctgcagcgctggcgccagggtgctagtggggggtctgggggcgcg
agcccggcggggatcgggggcgcaggcgcggcggcaggggcagggggccgcgcgctggag
ctggccgaagcccggcggcgactgctggaagtggagggccgccggcgcctagtgtcggag
ctggagagccgggtgctgcagctgcaccgagtctttttggctgccgagctgcgcctggcg
catcgcgccgagagcctgagccgcttgagtggcggcgtggcccaggccgagctctacctg
gcagcgcacgggtcgcgtctcaagaagggtgcgcgccgcggtcgccggggtcgtccccct
gcgctgctggcgtccgccctcggcctggggagctgcgtgccctggggcgcagggcggctg
cggcgcggccagggcccggagcccgactcgcccttccgccgcagcccgccccgcggcccc
gcctccccccagcgctga

DBGET integrated database retrieval system