KEGG   Rattus norvegicus (rat): 689025Help
Entry
689025            CDS       T01003                                 

Gene name
Mrps28, LRRGT00031, Mrps28l
Definition
(RefSeq) mitochondrial ribosomal protein S28
  KO
K17407  small subunit ribosomal protein S28
Organism
rno  Rattus norvegicus (rat)
Brite
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    689025 (Mrps28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S35
Motif
Other DBs
NCBI-GeneID: 689025
NCBI-ProteinID: NP_001041374
RGD: 1597461
Ensembl: ENSRNOG00000032630
UniProt: Q6TXG8
Position
2q23
AA seq 235 aa AA seqDB search
MHIPAPLGPVLSRVIVVSYLLCLSSGSSVRRKGRRRKQKSITYKCLLEQTSTFGFELIQH
SVSVQQIGFESPKPVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVEDDLYIDFGGKFHC
VCKRPDVDGELTCCGKVNMNAIEIVLLRIVWVLPESLQISNGLQSVCHFESTAGRCKACT
VTVSAIFHSYLFAKHVGGSLQTTVNQTFVTVTGAGSNEVQLDSASPLKSLDVEIL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcacatccctgctcccctcggccctgtgctttcgagagtcattgtggtatcctatctc
ctctgcctttcctctggttcttctgtgagaaggaaagggaggaggaggaaacaaaagagt
ataacttacaaatgtcttttggagcaaacttccacttttggttttgaattaattcagcac
agtgtgagtgtacagcagattggttttgagtctccaaaacctgtggaatcctttgcctcc
atgctgagacactctccactgacacagatggggcctgccaaggacaaactggtcattggg
cggatctttcacatcgtggaggatgatctctacatagattttggtggcaagtttcactgt
gtatgtaaaagaccagacgtggatggcgagttgacctgctgtggcaaagtgaacatgaac
gccatagaaatcgttttgctgagaattgtgtgggttcttcctgaaagtcttcagattagt
aatggtctacaaagtgtctgtcactttgaaagtactgcaggaaggtgtaaggcctgtaca
gttactgtttcagccatctttcattcctatttgtttgcaaaacatgtgggtgggagctta
caaacaaccgttaaccagacctttgtcactgtcacaggagcaggcagtaatgaggtccag
cttgacagtgcctcacctctgaagagcctggatgttgagatcctgtag

DBGET integrated database retrieval system