KEGG   Rattus norvegicus (rat): 689055
Entry
689055            CDS       T01003                                 

Gene name
Rad51ap1
Definition
(RefSeq) RAD51 associated protein 1
  KO
K20778  RAD51-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    689055 (Rad51ap1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     689055 (Rad51ap1)
SSDB
Motif
Pfam: RAD51_interact
Other DBs
NCBI-GeneID: 689055
NCBI-ProteinID: NP_001073179
RGD: 1597431
Ensembl: ENSRNOG00000059878
UniProt: A1A5P3
Position
4q42
AA seq 337 aa
MVRPTRNKKPVNYSQFEDSGNDSDDDFISASIPVNKSKTVPKVLKQDKPKPNLKNLQKEE
VLPTEPPKKRMALDDKVFQRGLEVALALSVKELPTLTNQVKKPEERSTDTTGKRKTEKTD
KPPRVSNCSVASDDVDLNKITEEGDVRDVEGERRTTSKARAQQRRKLSEGSSGSSADGTE
PDSATGEDSESDPDFDESEESDEDFGVRRGKETKKKPVQKKPKAEKKERKSKPKREEASV
TSADPAPAAIKSGSPALPQPVGLPSEATRKPAKICSPSAESKRPKWVPPAASGSRNSSSS
SWAGTPARSPSQSLRLGLSRLAPVKSLHPSTTSSQVR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggtgcgccctaccagaaataaaaaaccagtcaattattcacagtttgaggattctggc
aatgactctgatgatgattttatttctgcatctatacctgtaaacaagtcaaaaaccgtg
ccaaaagtgttaaagcaagacaagccaaaacctaacttgaagaatctccaaaaagaagag
gtcttaccaacagaaccccctaaaaaaaggatggctttagatgacaaggtcttccagaga
ggcctagaagttgccctggccttatctgtgaaggaacttccaacactcaccaaccaagtg
aagaagcccgaagagagaagcactgacacaaccggcaaaaggaaaacggaaaagacagat
aaacctcctcgagtctctaactgcagtgtagccagtgatgatgtagatttgaacaagatc
acagaggagggggacgtcagagatgttgaaggagagaggagaacaacatctaaagccagg
gctcagcagaggaggaagctctcagaaggcagcagtggcagcagtgctgacggcactgag
ccggacagtgcgactggtgaagattcagaaagtgatcctgattttgatgagagtgaggaa
agcgatgaagactttggtgtgagaagaggtaaagaaacaaagaagaaaccagtgcagaag
aaacccaaagcagaaaagaaggaaaggaaatcaaaacccaaacgtgaggaggcatcagtg
acttcagcagacccagctccagctgccatcaaatcaggatctccagccttaccccagcca
gttggtcttccttccgaggccactaggaaaccagcaaaaatatgcagcccttcagcagaa
agcaagaggcccaagtgggtccccccagccgcctccgggagcagaaactctagcagcagc
tcatgggcaggaacccccgccaggtccccgagtcagagcctgcgtctgggcctctcccga
ttagcaccagttaagagtttgcatccaagtaccacaagcagccaagtacggtag

DBGET integrated database retrieval system