KEGG   Rattus norvegicus (rat): 689064
Entry
689064            CDS       T01003                                 

Definition
(RefSeq) beta-globin
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    689064
   05143 African trypanosomiasis
    689064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    689064
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    689064
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 689064
NCBI-ProteinID: NP_001104739
RGD: 1597422
Ensembl: ENSRNOG00000047098
UniProt: P11517 A0A1K0FUA6
Position
1q32
AA seq 147 aa
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttagtggcctgtggggaaaggtgaat
gctgataatgttggcgctgaggccctgggcaggctgctggttgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgcctctgctatcatgggtaacccccag
gtgaaggcccatggcaagaaggtgataaatgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccgtgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system