KEGG   Rattus norvegicus (rat): 689103Help
Entry
689103            CDS       T01003                                 

Gene name
Best4
Definition
(RefSeq) bestrophin 4
  KO
K13881  bestrophin-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    689103 (Best4)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   689103 (Best4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bestrophin
Motif
Other DBs
NCBI-GeneID: 689103
NCBI-ProteinID: XP_001066317
RGD: 1596200
Ensembl: ENSRNOG00000018749
UniProt: D3ZX44
Position
5q36
AA seq 454 aa AA seqDB search
MTVSYTLKVAEARFGAFSGLLFRWRGSIYKLLYREFLLFCALYATLNITYRLLLTQEQKR
IYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQS
GRLLRRTLIRYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNK
YWVPCVWFTNLAAQARRDGRIRDDIALCLILEELNKYRAKCGMLFHYDWISIPLVYTQVV
TIAVYSFFTLSLIGRQFVESDKESSPAPWYLDMFVPLTTLLQFFFYAGWLKVAEQLINPF
GEDDDDFETNQLIDRNFQVSLLSVDDMYQNLPPTEQDLYWDEARPQPPYTVATAAESQRP
SFMGSTFNLRMSDDPEQCLQVEASRRFDLPAPVTQTSQTPLLGRFLAARAPSPAVSLQNL
RTSHLLHLRPGGEEAEGRIEEAVDEGSENEAMEP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgtcttacactctcaaagtggcagaggcacgcttcggagccttctctggcctg
ctcttccgctggaggggcagcatctacaagctcctgtacagagagttcctgctcttctgc
gccttgtatgctacactcaacatcacctacaggctgttgctgacccaggagcagaagcgt
atttatgcccaggtggcccgatattgcaaccgttcagcagacctcatccccttgtccttt
gtgctgggtttctacgtgactttggtggtgaaccgttggtggtctcagtacacaagcatt
ccactgccggaccagttaatgtgtgtcatctcagccagtgtgcacggtgtggaccagagt
ggccgtttgctacgccgaactctcatccgctatgccaacctggcatcggttttggtgcta
cgttccgtgagcacccgtgtactcaagcgcttccccaccatggagcatgtggtggacgca
ggtttcatgtctcaggaagagaggaaaaagtttgagagcttgaaatcggactttaacaag
tactgggtgccttgtgtctggttcactaatctggccgctcaggcccgcagagatggacga
atccgtgacgacatcgctctctgtctcatactggaagagctgaacaagtatcgggccaaa
tgcggcatgttgttccactatgactggatcagcatcccccttgtctacacacaggtggtg
acgatagctgtctattccttcttcaccctttccctgattggccgccagtttgtggagtca
gacaaggagtcctctccagccccgtggtacctggacatgttcgtgcctctcaccacattg
ctgcagtttttcttttatgctggttggctcaaggtagctgaacagctcattaaccccttt
ggtgaggatgatgacgactttgagacaaatcagctcatagaccgaaactttcaggtgtcc
ctgctctctgtggatgatatgtaccagaacctgcctcccactgagcaggatctgtactgg
gatgaggctcgacctcagccaccctatacggtggccacagctgctgagtcacaacgtcct
tccttcatgggttccactttcaacctgcgcatgagtgatgacccggagcagtgcctgcag
gtggaggcatctcggaggttcgacctgccagcgcccgtcacacagacctcgcagaccccg
ctgctgggccgcttcctggctgcaagagcgccctcacctgctgtaagcctgcagaacctc
aggacctcacacctgctgcacctgcgacctggcggtgaggaggctgagggccgcattgaa
gaggctgtggatgaaggatctgagaatgaagccatggaaccctga

DBGET integrated database retrieval system