KEGG   Rattus norvegicus (rat): 689134
Entry
689134            CDS       T01003                                 

Gene name
Sec61g
Definition
(RefSeq) protein transport protein Sec61 subunit gamma
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    689134 (Sec61g)
   04141 Protein processing in endoplasmic reticulum
    689134 (Sec61g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    689134 (Sec61g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    689134 (Sec61g)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   689134 (Sec61g)
SSDB
Motif
Pfam: SecE Pho88
Other DBs
NCBI-GeneID: 689134
NCBI-ProteinID: NP_001128492
RGD: 1596170
Ensembl: ENSRNOG00000005203
UniProt: B5DEL7
Position
14
AA seq 68 aa
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgtcgagccaagtcggcagtttgtaaaggactcgattcgg
ctggttaaaagatgcaccaaacctgatagaaaagaattccagaagatcgccatggccaca
gcgattggattcgctatcatggggttcatcggcttctttgtgaaactgatccacatccct
attaataacattattgtgggtggctga

DBGET integrated database retrieval system