KEGG   Rattus norvegicus (rat): 689172
Entry
689172            CDS       T01003                                 

Gene name
Tmem25
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    689172 (Tmem25)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  TMEM25
   689172 (Tmem25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 689172
NCBI-ProteinID: NP_001102998
RGD: 1596132
Ensembl: ENSRNOG00000014218
UniProt: D3Z9V8
Position
8q22
AA seq 365 aa
MELPLSQATLRHTLLLLPALLSSGQGELAPQIDGQTWAERALRENEHHAFTCRVAGGSAT
PRLAWYLDGQLQKATTSRLLSVGGDAFSGGTSTFTVTAQRSQHELNCSLQDPGSGRPANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNASDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRIEVPLLGIVV
AGGLAFGTLVGFSTLVACLVCRKEKKTKGPSRRPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDIRGKATERPMAQHSSRPELLEAEPGGLLTSRGFIRLPMLGYIYRVSSVSS
DEIWL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggagttgcctctaagccaagctacgctccggcatactctgctgctcctgcctgccctc
ttaagttcaggtcaaggagagctggcgccacaaattgatggtcagacctgggctgagaga
gcacttagggaaaatgagcaccatgctttcacctgtcgggttgcagggggttctgccact
ccccgattagcctggtacctggatggacagctacagaaggctaccacctcgcgactcctg
agtgtgggcggggacgccttctctggaggtaccagcactttcactgtcactgcccagcgc
tcccaacatgagcttaactgctccctgcaggacccagggagtggccggccagccaatgcc
tctgtcattctcaatgtgcaattcaaaccagagattgcccaggttggagccaagtaccag
gaagctcagggcccaggccttctggttgtcctgtttgccctggtacgggccaacccacct
gccaatgtcacctggattgaccaggatgggccagtgactgtcaatgcctctgacttcctg
gtgctggatgcccagaactatccctggctcaccaaccacactgtgcagctgcagctccga
agcctggcacacaacctctcggtggtggccaccaacgatgtgggtgtcaccagtgcctca
cttccagctccagggctcctggccacacggatagaagtgccactgctgggcatcgttgtg
gctggaggacttgcctttggcactctagtgggattcagtaccttggtggcctgcctggtc
tgcaggaaagagaagaaaacaaaaggcccctcccggcgtccttctctgatatctagtgac
tccaataacctgaaactgaataatgtgcgcctgccccgggagaacatgtccctcccatcc
aaccttcagctcaatgacctcactccggatatcagagggaaagcaacagagcggccaatg
gctcagcatagcagccgtccagagcttctagaagcggagcctggtggcctcctcaccagc
cgaggtttcatccgtctcccaatgttgggctacatctaccgtgtgtccagcgtaagcagt
gatgagatttggctctga

DBGET integrated database retrieval system