KEGG   Rattus norvegicus (rat): 689226
Entry
689226            CDS       T01003                                 

Gene name
Ube2r2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2R 2
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    689226 (Ube2r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    689226 (Ube2r2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     689226 (Ube2r2)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   689226 (Ube2r2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 689226
NCBI-ProteinID: NP_001121045
RGD: 1594826
Ensembl: ENSRNOG00000010727
Vega: OTTRNOG00000000934
UniProt: B2RZ96
Position
5q22
AA seq 238 aa
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcccagcagcagatgaccagctcgcaaaaagccctgatgcttgagctgaaatccctg
caggaggaaccggtggagggcttccggatcaccctggtggatgagtccgacctctacaac
tgggaggtggccatcttcggaccccctaacaccctctacgaaggcggctacttcaaggca
catattaaatttcctattgactacccatattcaccacctaccttcagattcttgaccaaa
atgtggcaccccaacatctatgagaatggagatgtatgcatttcaatccttcatccgcct
gtagatgacccacagagtggagagctgccctctgaaaggtggaatcctactcagaatgtg
aggactatcctgctgagtgtaatctccctgcttaatgagcccaacaccttttctccagcc
aatgtggatgcttcagtcatgttcaggaaatggagggacagcaaaggaaaggacaaggag
tacgctgagatcattaggaaacaggtctcagccacgaaagctgaagcagaaaaggatgga
gtgaaggtccccacaaccctggcagaatactgcatcaaaactaaagtgccttccaatgac
aacagctcagatttgctttatgacgacctgtatgacgacgacattgatgacgaagacgag
gaggaagaagatgccgactgttatgatgatgatgactctggaaatgaggagtcgtga

DBGET integrated database retrieval system