KEGG   Rattus norvegicus (rat): 689388
Entry
689388            CDS       T01003                                 

Gene name
Ptx3
Definition
(RefSeq) pentraxin 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Pentaxin Laminin_G_3
Other DBs
NCBI-GeneID: 689388
NCBI-ProteinID: NP_001103006
RGD: 1593476
Ensembl: ENSRNOG00000012280
UniProt: D3ZT94
Position
2q31
AA seq 381 aa
MHLPVILLCALWSAVLAETSYDYELMHVNLDNEIDNGLHPTEDPTPCDCRQEHSEWDKLF
IMLENSQMREAMLLQATDDVLRGELQRLRAELGRLAGGMARPCSASGPADARLAQALEPL
LQESRDANRRLARLEDAEARRHEATVPSLGAVLEELQRTRADLSAMQSWVARHWLPAGCE
TAIFFPMRSKKIFGSVHPVRPMKLESFSACIWVKATDVLNKTILFSYGTKWNPYEIQLYL
SSQSLVFVVGGKENKLAADTVVSLGRWSHLCGTWSSEQGSMSLWANGELVATTLEMAKSH
PVPEGGLLQIGQEKNGCCVGGGFDETLAFSGRITGFNIWDRVLSKEEIRASGGAESCHIR
GNIVGWGVTEIQAHGGAQYVS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcatctccctgtgattctgctttgtgctctctggtctgcagtgttggctgagacctcc
tatgactatgagctcatgcatgtgaatttggacaacgaaatagacaatggacttcatccc
accgaggaccccacaccatgcgactgccgccaggaacactcggagtgggacaagctgttc
atcatgctggagaactcgcagatgcgggaggccatgctgttacaggccactgacgacgtc
ctccgcggggagttgcagaggctgcgggcggaactggggcggctggcgggcggtatggcg
aggccttgctcagccagtggcccggcagacgccaggctggcacaggcgctggagccgctg
ctgcaggagagccgcgacgcgaaccgcaggctggcacgcctggaagatgcagaggcgcgg
cgacacgaggcgacagtgcctagcctaggagcggtgctggaggaactgcagcggacgcgc
gccgacctgagcgccatgcagagctgggtcgctcgccactggctacccgcaggctgtgaa
acagcgattttcttcccaatgcgttctaagaagatttttggaagcgtgcatcctgtgaga
ccaatgaagcttgaatcttttagtgcttgtatttgggtcaaagccacagacgtattaaac
aaaaccatcctgttttcctatggcaccaagtggaacccctatgagatccagctgtaccta
agttcccagtccctagtgtttgtggtgggtgggaaggagaacaagctggctgcggatact
gtggtctccctggggaggtggtcccacctgtgtggcacgtggagttcagagcaggggagc
atgtccttgtgggcaaatggggaactggtggctaccactctggagatggccaaaagtcac
cctgttcctgagggtggactcctacagattggccaagaaaagaatggttgctgtgtaggt
gggggctttgacgaaacattggcattttctggaagaatcacaggcttcaatatctgggat
cgagttctcagcaaggaggagataagggcaagtgggggagccgaatcatgccacatccgg
ggaaacatcgtcgggtggggagtcacagagattcaggctcatggaggagctcagtatgtt
tcttaa

DBGET integrated database retrieval system