KEGG   Rattus norvegicus (rat): 689414
Entry
689414            CDS       T01003                                 

Gene name
Slc25a42
Definition
(RefSeq) solute carrier family 25, member 42
  KO
K15085  solute carrier family 25, member 42
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    689414 (Slc25a42)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   689414 (Slc25a42)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 689414
NCBI-ProteinID: NP_001121062
RGD: 1592346
Ensembl: ENSRNOG00000020345
UniProt: B1H271
Position
16p14
AA seq 318 aa
MDNGVQEGSVRLGEDAEAVLAGAVSTKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGH
YYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE
EGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIG
QSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVG
ISFTTFDLMQILLRQLQS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggataatggtgtgcaggaaggctcggtgcgcctgggagaggatgctgaagccgtcctg
gccggggccgtctccacaaagagagaccacaggcaagttctcagctccctgctatctgga
gccctggccggtgcacttgccaagacagcagtagcccccctagaccggaccaagatcatc
ttccaagtgtcttcaaaaagattttctgccaaggaggccttccggctcctctacttcacc
tacctcaacgagggcttcctcagcctatggcgtgggaactcggccaccatggtgcgagtg
attccttacgcagccatccagttcagcgcacacgaagaatacaaacgcatcctgggccac
tactatggctttcgtggagaagccctgcccccatggccacgcctcctggctggcgccttg
gcaggaaccaccgcggcttccctcacgtaccctctggacctggtcagagcaaggatggct
gtgacgcccaaggagatgtacagcaacatctttcatgtcttcatccgcatctcaagagag
gaaggactgaagaccctttatttcgggttcacacccactgtgctgggtgtcattccctat
gcgggactcagcttctttacgtacgagtcactgaagagcctacaccgagagtacagtggt
cgcccgcagccctacccctttgagcgcatggtcttcggggcctgtgctggccttatcggg
cagtcggcctcctaccctctggacgtggtgcggcggcgcatgcagacagcaggtgtcaca
ggccaccagcacggctccatcctgagcacgctacgctccattgtccgtgaggagggcgcg
gtgcgggggctctacaaaggtctgagcatgaactggctgaaagggccgattgctgtgggg
atcagcttcaccactttcgacctcatgcagatcctgctgcgccagctgcagagctag

DBGET integrated database retrieval system