KEGG   Rattus norvegicus (rat): 689415
Entry
689415            CDS       T01003                                 

Gene name
Mt2A
Definition
(RefSeq) metallothionein 2A
  KO
K14739  metallothionein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    689415 (Mt2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    689415 (Mt2A)
   03029 Mitochondrial biogenesis [BR:rno03029]
    689415 (Mt2A)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     689415 (Mt2A)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    689415 (Mt2A)
SSDB
Motif
Pfam: Metallothio
Other DBs
NCBI-GeneID: 689415
NCBI-ProteinID: NP_001131036
RGD: 1592345
Ensembl: ENSRNOG00000043098
UniProt: P04355 B6ID08
Position
19
AA seq 61 aa
MDPNCSCATDGSCSCAGSCKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCC
A
NT seq 186 nt   +upstreamnt  +downstreamnt
atggaccccaactgctcctgtgccacagatggatcctgctcctgcgctggctcctgcaaa
tgcaaacaatgcaaatgcacctcctgcaagaaaagctgctgttcctgctgccccgtgggc
tgtgcgaagtgctcccagggctgcatctgcaaagaggcttcggacaagtgcagctgctgc
gcctga

DBGET integrated database retrieval system