KEGG   Rattus norvegicus (rat): 689425Help
Entry
689425            CDS       T01003                                 

Gene name
Clpsl2
Definition
(RefSeq) colipase-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Colipase-like
Motif
Other DBs
NCBI-GeneID: 689425
NCBI-ProteinID: NP_001128474
RGD: 1592336
Ensembl: ENSRNOG00000038807
UniProt: D3ZVN1
Position
20p12
AA seq 104 aa AA seqDB search
MAFTQALVTVLAFLVGTLPHKFDFSENSDLKKANGDKCVHHSQCFSDCCLIDLERSGAFC
TSKSHVGMACLPQTKRSLNILCPCRIGLSCHSKDPMCPRRCQMI
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggccttcacccaggccttggtcaccgtgctggcttttcttgttgggaccctgccacac
aaattcgacttcagtgaaaactcagaccttaaaaaggccaacggagacaagtgtgtccac
cacagccagtgctttagtgactgttgcctcatagacctggaaagaagcggggccttctgc
acctctaagtcccatgtaggcatggcgtgcttgccgcagaccaagcggagcctgaacatc
ctgtgtccctgtcgaattggcttgagctgtcattctaaggaccccatgtgtccccgccgg
tgtcagatgatatag

DBGET integrated database retrieval system