KEGG   Rattus norvegicus (rat): 689560
Entry
689560            CDS       T01003                                 

Gene name
Ryr2
Definition
(RefSeq) ryanodine receptor 2 isoform 1
  KO
K04962  ryanodine receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04911  Insulin secretion
rno04921  Oxytocin signaling pathway
rno04972  Pancreatic secretion
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    689560 (Ryr2)
   04020 Calcium signaling pathway
    689560 (Ryr2)
   04024 cAMP signaling pathway
    689560 (Ryr2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    689560 (Ryr2)
   04921 Oxytocin signaling pathway
    689560 (Ryr2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    689560 (Ryr2)
   04261 Adrenergic signaling in cardiomyocytes
    689560 (Ryr2)
  09154 Digestive system
   04972 Pancreatic secretion
    689560 (Ryr2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    689560 (Ryr2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    689560 (Ryr2)
   05022 Pathways of neurodegeneration - multiple diseases
    689560 (Ryr2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    689560 (Ryr2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    689560 (Ryr2)
   05414 Dilated cardiomyopathy
    689560 (Ryr2)
   05415 Diabetic cardiomyopathy
    689560 (Ryr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    689560 (Ryr2)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    689560 (Ryr2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Ryanodine receptor
   689560 (Ryr2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   689560 (Ryr2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 689560
NCBI-ProteinID: NP_114467
RGD: 620314
Ensembl: ENSRNOG00000017060
UniProt: B0LPN4
Position
17
AA seq 4953 aa
MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAGGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGKFMMKTAQGGGHRTLLYGHAILLRHSYSG
MYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVS
SERYLHLSYGNSSWRVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTV
PSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLS
LMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDAGVRKEVDGMGTSEIKYGDSICYIQHVD
TGLRLTYQAVDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFN
RFIRGLDALSKRAKLPTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQN
LFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKN
CAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRN
HKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGS
AQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGF
DGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGL
FFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREYKQERTYT
RDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPV
RDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLP
KNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNR
RNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRI
FRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDERAFAFDGFKAQRWHQ
GNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSL
GVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEH
IEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKSVAGGIPGAGF
YGPKNDLEDFDVDSDFEVLMKTAHGHLVPDRMDKDKETPKPEFNNHKDYAQEKPSRLKQR
FLLRRTKPDYSTSHSARLTEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWIT
SDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLE
IGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPL
SAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQ
FMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLL
YAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKH
GLPGIGLSTSLRPRMCFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVKEGSLHA
RDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILRLIEPSVFKEAATPEEEGGAPEK
EISIDDSKLEVKEEAKAGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAF
SDDFVAKLQDNQRFRYNEVMQALNMSAALTARKEFRSPPQEQINMLLNFKDDKSECPCPE
EIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVAS
DSRKSSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTING
VSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHET
VMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLA
SPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGW
NPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEA
IKIAEDPSRDGPSPTSGSSKTLDAEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIH
AGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDHKAAMVL
FLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTR
CAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLR
RLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWSNFGAASEEELHLSRKLFWGIFD
ALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNSNPQPVDTSN
ITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEI
YRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSN
VTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQ
DIFKFLQISGYAVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSK
GEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEKEMVTSLFCK
LGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFLDNAAEDLEK
TMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSC
YRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLDKHNVYSIYNTRSSR
ERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGTRYTQMPHMMGVVLPMLCSYMSRWW
EHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKV
KPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARNLYAFY
PLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSF
LITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIA
LAKNRFSLKDTEEEVRDVIRSNIHLQGKLEDPAIRWQMALYKDLPNRAEDTSDPERTVER
ILDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQ
GYEKSWIETEEHYFEDKLIEDLAKPGSELPEEDEAMKRVDPLHQLILLFSRTALTEKCKL
EEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDR
GAAEMVLQTFSASKGETGPMVAATLKLGIATLNGGNSTVQQKMLDYLKEKKDVGFFQSLA
GLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDF
QNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIGEQGQRNFSKAIQVAK
QVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDL
QKDMVVMLLSMLEGNVVNGTIGKQMVDMLAESSNNVEMILKFFDMFLKLKDLTSSDTFKE
YDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDI
GFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISE
SSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESGLNER
SANKEESEKERPEEQAPRMGFFSLLTVQSALFALRYNVLTLVRMLSLKSLKKQMKRMKKM
TAKDMVSAFFSSYWSVFVTLLHFVASVCRGFFRIVSSLLLGGSLVEGAKKIKVAELLANM
PDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLI
PHNPNAGLSDLMTNPIPVPEVQEKFQEQKVKEEKEGKEETKSEPEKAEGEDGEKEEKAKD
DKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINF
ILLFYKVSTSSVVEGKELPTRTSSDAAKVTTSLDSGPHRIIAVHYVLEESSGYMEPTLRI
LAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLV
INTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSGAREKKKPKKDSSL
SAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLR
TILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYM
FHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELR
DQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHT
GQESYVWKMHQERCWEFFPAGDCFRKQYEDQLN
NT seq 14862 nt   +upstreamnt  +downstreamnt
atggctgatgcgggcgaaggcgaggacgagatccagttcctgagaactgatgatgaggtg
gttctacagtgcaccgcaaccatccacaaagagcagcagaagctgtgcttggctgcagga
ggatttggcaacagactttgctttttggagtctacttccaattctaagaatgtccccccg
gacctgtccatctgcacctttgtgctggagcagtccctgtcagtacgggccctgcaggag
atgctagccaacacagtggaaaagtcagaagggaagttcatgatgaagactgctcaaggt
ggaggccaccggacactcctctatggacacgccatactactacgccattcctacagtggt
atgtatctctgctgtctctccacctcccggtcttccaccgacaaactggcctttgatgtt
ggccttcaagaggataccacaggggaggcttgctggtggaccatacatcctgcctctaag
cagagatcagaaggagaaaaggtgcgggttggagacgacctcatattggtcagcgtgtcc
tcagaaaggtacttgcacttgtcatacggcaacagcagctggcgtgtagacgcagccttc
cagcagaccctctggagcgtggcccctatcagctcaggaagtgaagcagcccaagggtat
ctcattggtggtgatgttctccggctgctacatggacacatggatgaatgtctcactgtt
ccttcaggagaacatggtgaagaacagcggagaacagtccattatgaaggtggtgctgta
tcagttcatgcccgctccctctggagactagagaccctaagagtcgcgtggagtggaagt
cacataagatggggccagccattccgactgcggcacgtcacgacaggaaaatacttaagc
ctcatggaagacaagaaccttctactcatggacaaagaaaaagctgatgtaaaatcaacg
gcgtttgccttccggtcttccaaggaaaaattggatgcaggtgtaaggaaagaagtcgat
ggcatgggaacctcagaaatcaagtatggagactccatttgctatatacaacatgtggac
acgggcctgcggctaacctaccaggccgtggatgtcaaatcagcacgaatgggatccata
cagcgtaaggctatcatgcaccacgaaggccacatggatgacggcttgaacttatccaga
tcgcagcacgaggagtcccgcactgcccgtgtcatccggagcacagtgtttctcttcaat
aggttcataaggggcctggatgctctcagcaagagagcgaagctgcccactgttgacttg
cccatcgagtctgtgagcctgagtttgcaggacctcatcggctacttccaccccccagac
gagcacctggagcacgaggacaagcagaacaggctgcgagccctgaagaaccggcagaat
ctcttccaggaagagggaatgatcaacctggttctggagtgcatcgaccgcctccatgtc
tacagcagtgcagcccactttgcagacgttgcaggacgagaagcgggggagtcttggaaa
tccatcctgaattctctgtatgagttgctggcggctctaattagaggaaatcgtaaaaac
tgtgctcaattttctggctccctcgactggctgatcagcagactggagagactggaagcg
tcctctggtatcctggaggtcctccactgtgtgttagtggagagcccggaagctctgaat
atcatcaaagaaggacacatcaagtccattatttcccttttagacaagcatgggagaaac
cacaaggtcctggatgtgctgtgttctctctgtgtgtgccatggagttgccgtccgttct
aatcagcatctcatctgtgataacctcctgccgggacgagacctcttactgcagacccgg
cttgtgaatcatgtcagcagcatgaggcctaatattttcctgggtgtcagcgaaggatca
gcacagtataagaagtggtactacgagctcatggtggaccacacggaaccctttgtgacc
gcagaagccactcacctgcgagtgggctgggcttccactgaagggtattccccgtaccca
ggtgggggtgaagagtggggtggcaatggcgttggtgatgacctcttctcctatgggttt
gatggccttcacctctggtcaggttgtatagctcgaacagtgagctcccccaaccagcac
ctgctgagaactgatgatgtcataagttgctgtttagatctaagtgccccgagcatctcg
tttcgcattaatggacaacctgtgcaagggatgtttgagaacttcaatatcgatggcctg
ttctttccggttgtcagtttctctgcaggaataaaggttcgctttttgcttggggggaga
cacggagaattcaaatttctccctccaccgggctatgcagcttgctatgaagctgttttg
cccaaagagaaattgaaggtggaacacagccgagaatataagcaagagaggacgtacaca
cgagacctgctggggcctacagtgtccctgacccaagctgccttcacacctgttcctgtg
gacaccagccagattgtgttgcctcctcacctggaaaggataagagaaagactggcagaa
aatatccacgagctctgggttatgaataaaattgagcttggctggcagtatggtccggtt
agagatgacaacaagagacagcacccatgtctggtggagttctgcaagcttccggaacag
gaacgcaactacaatttgcagatgtctctggaaaccctcaagactttgctggcattagga
tgtcatgtgggtatagcggatgaacatgctgaagagaaggtgaagaaaatgaagctgccc
aagaattaccagctgaccagtggatacaagcctgcccccatggatctgagctttataaaa
cttaccccgtctcaggaagcaatggtggacaagttggctgaaaatgctcacaacgtgtgg
gcccgggaccgaatccggcagggctggacttacggcatccagcaggatgtgaagaacagg
agaaaccctcgtctggttccctacactcttctggatgacagaaccaagaagtccaacaaa
gacagtctccgagaggcagtgcgaacactgctgggctacggctaccacctggaagctcct
gatcaggaccacgcctcaagagccgaggtgtgcagcggtactggggagaggttccgcatc
ttcagggcagagaagacctatgcagtaaaggctgggcgctggtactttgaatttgaggcc
gtcactgctggagacatgagggtgggatggagcaggccaggctgccaaccggatctagaa
ctgggttctgatgaacgtgccttcgcttttgacggctttaaggcccagcggtggcaccag
ggcaatgaacactacgggcgttcttggcaagcaggtgatgtcgtgggctgcatggttgat
atgaatgaacacaccatgatgttcactctgaacggtgagatcctgctggatgactcaggc
tccgagctggctttcaaggactttgatgttggtgacggattcatccctgtgtgtagcctc
ggggtggcacaagtaggcaggatgaactttggaaaggacgtcagcactttgaaatacttt
accatctgtggcttacaagagggctacgagccatttgcagttaacacaaatagggacatc
accatgtggctgagcaagcggcttcctcagttcctccaggtcccctcaaaccacgaacac
atcgaggtgaccagaatagatggtaccatagacagttctccatgtctgaaggtcactcag
aagtcctttggttctcagaacagcaacacagacatcatgttttaccgcctgagtatgccc
attgagtgtgctgaggtcttctcaaagtccgtggctggagggatccctggcgccggcttc
tatgggcccaagaatgatttggaggactttgatgtggattctgactttgaggttctgatg
aagacagctcatggtcatcttgtgcccgaccgcatggacaaggacaaagagacccccaag
ccagaattcaataaccacaaagattatgctcaggaaaagccctcacgcctaaagcaaaga
ttcttacttagaaggaccaagccagattacagcacaagccattctgcaagactcactgaa
gacgtccttgctgatgaccgggatgactatgaatatctgatgcagacatctacatactat
tattcagtgaggatctttcctggacaagaaccagctaacgtctgggtgggctggattaca
tctgacttccaccagtatgacacaggcttcgatttggacagagtgcgcacagtgacagtc
accctaggagatgaaaaagggaaagtgcacgagagcatcaaacgcagcaactgctatatg
gtgtgtgcgggagagagcatgagccccgggcaaggccgaaacaacagcaatggcttggag
atcggctgtgtggtggacgctgccagtgggctgctcacattcatagccaacggcaaggag
ctaagcacttactatcaggtggagccaagcacgaagttatttcctgcggttttcgcgcaa
gctacaagtcccaatgttttccagtttgagttgggcagaataaagaatgtgatgcctctc
tcagcgggattgtttaagagtgagcacaaaaaccccgtgccccagtgtcctccacgtctg
cacgtgcagttcctgtcacatgtcctgtggagccggatgcccaaccagttcctcaaggtg
gacgtctctcgaatcagtgaacgccaaggctggctggtgcagtgtctggatcctctgcag
ttcatgtccctccacatccccgaggagaacagatctgttgatatcttagagctgaccgag
caggaggagttgttgcagtttcactaccacaccctccgcctctactctgcagtctgtgcc
cttgggaatcaccgggtggcgcatgcactgtgcagccacgtggacgaacctcagctgctc
tatgccattgagaacaagtacatgcctggcttgctgcgagccgggtactatgacctgctg
attgacatccacctcagctcctacgccaccgccaggctcatgatgaacaatgagttcatc
gtcccgatgacagaggagacaaagagcatcaccctcttccctgatgagaacaagaaacat
ggcctcccgggcataggcctcagcacctctctccgccctcggatgtgcttttcctcccct
agtttcgtgagcattagcaacgaatgctatcagtatagtcccgagttcccactggacatc
ctcaaggccaagaccatccagatgctcacagaagcggtgaaggagggcagcctccacgcg
cgggatcccgtgggcgggaccaccgagttcctctttgtgcctctcatcaagctcttctac
accctgctcatcatgggcatctttcacaatgaggatttgaaacacatcctgcggttgatt
gagcctagtgtgtttaaggaagctgccactccagaggaggaaggaggtgccccagagaag
gagattagtatagacgactctaaactggaagtcaaagaggaagccaaagcaggcaaaagg
cctaaggaaggcttactccagatgaaactcccggagcctgttaaactacagatgtgcctc
ttgcttcagtacctctgtgactgccaggttcggcaccggatagaagccattgtagccttt
tcagatgactttgtagccaaactccaagacaatcagcggttcaggtataatgaagtcatg
caagccttaaacatgtctgctgcactcactgccaggaaggagttccggtcaccaccacag
gagcagatcaatatgcttcttaattttaaggatgataaaagtgaatgcccctgccctgaa
gaaatccgagaccaactcctagatttccatgaggacctgatgactcactgtggaattgaa
ctggatgaagatggatctctagacggaagcaatgacttaacaatcagaggacgtctgctg
tccctggtagaaaaggtgacctacctgaagaaaaagcaagctgaaaaaccagtcgcaagt
gactccagaaagtcctccagcctccagcaactcatttctgagactatggtgcggtgggct
caagagtctgtcatcgaggaccctgagctggtgagggctatgtttgtgctgctgcaccgg
cagtatgatggcattgggggtctcgttcgagcactgccaaagacctacactatcaacggc
gtctctgtggaggacaccatcaatctgcttgcatcacttggtcagatccgatccctgctg
agtgtgaggatgggcaaagaagaagagaagctgatgatccgaggattaggggatattatg
aataacaaggtgttttatcagcatcccaatctcatgagggcccttgggatgcacgaaaca
gtgatggaagtcatggtgaacgtccttggaggtggggagtccaaggaaatcaccttcccc
aagatggtggccaactgctgccgttttctctgttacttctgtcgtataagtaggcagaat
cagaaagccatgtttgatcatctcagttatttactggaaaacagcagtgttggtcttgcc
tcaccagccatgagaggttcaactccattagacgtggccgcagcgtcagtgatggataac
aatgagcttgcccttgctctacgagagccggatctggagaaggtggttcgctatctggcc
ggctgtggtctgcagagctgccagatgctggtgtctaagggttacccagacattgggtgg
aatccagttgaaggagaacgatatcttgactttctcagatttgccgtcttctgtaatggg
gagagtgtggaagagaatgcaaatgttgtggtgaggttgctcatccggagaccggagtgc
tttggccctgccttgagaggagaaggtggtaatggtctccttgcagccatggaagaagcc
ataaaaatagctgaggatccttctagagatggcccctctccaaccagtggatccagcaaa
acccttgatgcggaagaggaggaagacgacaccatccacatggggaacgcaatcatgacc
ttctacgcagctttgattgacctgcttggtcgctgtgctcctgaaatgcatttgattcat
gctggaaagggagaagccatccgaatcaggtctattttgcgatccctgattccattggga
gacttggtgggtgtaatcagcattgcatttcagatgccaacaatagccaaagatgggaag
gtggtggagcctgacatgtccgcggggttttgcccagatcacaaggcagccatggttttg
ttccttgacagggtctatggaattgaggtgcaagatttcctcctccatctccttgaggtt
ggctttctgccagatcttcgcgctgctgcctctctagacacggctgcactaagtgctaca
gacatggccttggccctcaatcggtacctctgcacagctgtcctgcctttgttaacgaga
tgtgctcccctgtttgctggaacagagcaccatgcttccctcattgactctctgctacac
actgtatatagactctctaagggatgttccctcaccaaagctcagcgggactccatagaa
gtgtgcctgctctctatatgtggccaactgcgaccttctatgatgcagcacctactccga
aggctggtgtttgatgtcccactgctgaacgagcacgcaaagatgcctctaaagctgctg
accaatcattatgaaagatgctggaaatattactgcctacctggagggtggagcaacttt
ggtgctgcctcggaagaagaacttcatttatcaagaaaattattttggggcatttttgat
gctttgtctcaaaagaaatacgaacaagaacttttcaaactggccctgccttgcctgagt
gcagttgcgggagctttacctccagactacatggagtcaaactatgtcagtatgatggaa
aaacagtcatccatggactctgaagggaactctaacccacaacctgttgatacctcaaac
attacaattcccgagaagctggaatacttcattaacaagtatgcggagcattcccatgat
aaatggtctatggacaagttggcgaatggatggatttatggggaaatatattcagactct
tctaagatccagccactaatgaagccatataaactcttatctgaaaaggaaaaagaaatt
tatcgttggccaatcaaggagtctttaaaaacgatgctggcttggggttggagaattgag
aggacacgggagggagacagtatggccctttataaccggactcggcgcatttctcagact
agccaggtgtctatagatgctgcacatgggtatagcccccgtgctatcgacatgagtaac
gttaccctctcgagagacctgcatgctatggcggagatgatggctgaaaactaccacaac
atatgggccaagaaaaagaaaatggagctggaatccaaaggaggaggaaaccaccccctg
ctagtgccctacgacacactgacagccaaggagaaagccaaggacagagaaaaggcccag
gacatcttcaagttcctacagatcagtggttatgctgtatccagagggttcaaggacctg
gatctggacacaccttccattgagaagcgatttgcctacagtttcctgcagcagctgatc
cgatatgtggacgaggcccatcagtacatcctggagtttgacggtggcagcagaagcaaa
ggagagcatttcccgtacgagcaagagatcaagttcttcgccaaagttgttcttccttta
attgatcagtatttcaaaaaccatcgcctgtacttcttgtctgctgcaagcaggcctctt
tgcaccggaggacatgcgtccaacaaggagaaggagatggttacaagcctgttctgcaaa
cttggagttcttgtcaggcataggatttcactgtttgggaatgatgctacctcaattgtg
aactgtcttcatattttgggtcagactttggatgcaaggactgtgatgaagacgggtctg
gacagcgtgaaaagtgctctcagggcctttctggacaatgcggcggaggatctggaaaag
acgatggaaaaccttaagcagggccagtttactcacaccaggagccagcccaagggcgtg
actcagatcatcaactataccaccgtggcgctcctgcccatgctctcttccctgtttgag
cacattggccagcatcagtttggagaagatctgatattggaggatgtgcaggtgtcttgt
tacagaattctgaccagcttgtatgccttgggaaccagcaagagcatctatgtggaaagg
caacgttctgcactcggagaatgcctagctgcctttgctggtgccttccctatcgccttt
ctagaaacccacctggacaaacataatgtttactccatctacaacaccaggtcttcacga
gaaagagcagctctcagtttacccgcaaatgtggaggatgtctgcccaaatataccatcc
ctggagaagctcatgactgagatcatagagctggcagagtcaggaacccgttacactcag
atgccacacatgatgggggtggtactgcccatgttatgcagctacatgtcaaggtggtgg
gagcacggtcctgagaaccatccagagagggctgagatgtgctgcacagcgctcaactca
gagcacatgaacacactgctgggcaacattctcaagatcatctacaacaacctggggatt
gatgaaggggcctggatgaagcgcttagctgtattttcacagccaatcatcaacaaggtg
aaacctcagctcttaaaaactcatttcttacccttaatggagaaactaaagaaaaaggct
gccatggtagtgtctgaggaagaccacctaaaagccgaagccagaggggacatgtccgaa
gcggagctgctcattctagatgagtttaccacattggccaggaatctctatgccttctac
ccactcttgatccgatttgtggactataacagggcaaagtggctgaaggaacccaaccca
gaagcagaggagctatttcgaatggtagctgaagtcttcatttactggtccaaatcccat
aatttcaaaagagaggaacagaactttgtggtgcagaatgaaatcaacaacatgtccttc
ctcatcaccgacacaaagtctaagatgtccaaggcagccatttctgatcaagagaggaag
aaaatgaagcggaaaggagaccggtattctatgcagacatctttgattgtggcagctctg
aagcgattgcttcccattggactgaacatctgtgcccctggggaccaagagctcattgct
ctggccaaaaaccgatttagcttgaaagacactgaggaggaagtacgtgatgtaatccgc
agtaatatacacttgcaaggcaagctggaagaccctgcaatcaggtggcagatggctcta
tacaaagacttgccaaacagggcagaagacacctcagacccagagaggacagtggagcgt
atcctggatatagcgaatgtgctttttcaccttgaacaggtggagcaccctcagagatca
aagaaagccgtgtggcacaaactgctctctaagcagagaaaaagagctgttgttgcctgt
ttccggatggcccctttgtacaatctgccaaggcatcgggctgtcaatctctttcttcag
ggatatgaaaagtcttggattgaaacagaagagcattactttgaggataaattgatcgaa
gatttagcgaaaccggggtctgaactcccagaagaagatgaagccatgaaaagagttgat
cctctgcatcagcttattcttctgttcagccgcacagccttaacagagaaatgcaaactg
gaggaagattttctgtacatggcgtatgcagacattatggcaaagagttgtcacgatgaa
gaagacgatgatggtgaagaagaagtgaagagctttgaagtcacaggatcccaacgcagc
aaggaaaaggaaatggaaaagcagaagcttctgtaccagcaagccagactgcatgaccgc
ggggctgccgagatggttctccagaccttcagtgccagcaaaggtgaaactggaccaatg
gtggctgccactttgaagctgggtattgctactttaaatggtgggaactccacggtgcag
cagaagatgctggattacctgaaggagaaaaaagatgtaggcttcttccagagcctggca
ggcctcatgcagtcttgcagtgtcctggacctgaatgcctttgagaggcaaaacaaagca
gaaggacttgggatggtgactgaggaaggatcaggagagaaggtacttcaggatgatgag
ttcacctgtgacctcttccgattcctgcagctgctctgtgaaggacacaactcagatttt
cagaattacctgagaacccagactggcaacaacaccacagttaatatcatcatctctact
gtggactacctccttcgagtgcaggagtccattagtgatttctattggtactactctggc
aaggacatcataggtgagcagggccagcgtaacttttccaaagccatccaagtggcgaag
caggtgttcaacacactcacggagtacatccagggtccttgtaccggaaaccagcagagt
ttggcacacagcaggctctgggatgctgttgtgggcttccttcatgtatttgcacacatg
cagatgaagctgtctcaggattccagccagattgagctcttaaaagaactgatggatctc
caaaaggacatggtggtcatgctgctgtctatgctagagggtaatgtggtaaacggaaca
ataggcaagcagatggtggacatgcttgcggagtcatccaacaacgtggagatgatcctc
aagttctttgacatgtttctgaagttaaaggacttgacatcctctgacacatttaaagag
tatgaccctgatggcaaaggcgtcatttccaagagagacttccacaaagccatggagagc
cacaaacactacacccagtcagagactgagtttctgttgtcctgtgcagagacagatgag
aacgagacgctggattatgaagagtttgtcaaaaggttccacgagcctgccaaggacatc
ggcttcaacgtcgccgttctgctgaccaacctctcagagcacatgcccaatgacacgagg
ctgcagaccttcttggagctggcagagagtgtcctcaactacttccaacctttcctgggt
cgcatcgagatcatgggcagcgccaagcgcatcgagagggtctactttgagatcagcgaa
tccagccgaacccagtgggagaagccccaggtcaaggagtccaagaggcagttcatattc
gatgtggtcaatgagggcggggaaaaggagaagatggagctctttgtgaacttctgtgag
gacaccatctttgagatgcagctggcagctcagatctcagagtccggcctgaatgagagg
tcggcaaataaagaggagagtgaaaaggagaggccagaggagcaggccccacggatgggc
ttcttctccctgctcaccgtccagtcagccctgtttgcactcaggtacaatgtcctaacc
cttgtgaggatgctcagcctgaagagcctgaagaagcagatgaagagaatgaagaagatg
acagcgaaggacatggtctcagccttcttctcgtcctactggagtgtgtttgtcaccctc
ctacacttcgtggccagcgtctgtaggggcttcttccgcattgtctccagcctactgctg
gggggcagcctggtggaaggtgctaagaaaatcaaagtggcggagcttcttgccaacatg
ccagaccctactcaggatgaggtgcgaggagatgaagaggagggagagaggaagccatta
gagtcagccctgccctctgaagacctaacggacttgaaggaactgacggaggaaagtgac
cttctttcagacatatttggcttggatctgaagagagaaggagggcagtacaaactaatt
cctcacaacccaaatgctggtctcagtgacctcatgacgaaccccatccctgtccctgag
gtacaagaaaagtttcaggagcagaaggtaaaagaagaaaaggaaggaaaggaagaaacc
aagtctgaaccggagaaggctgagggagaggatggagaaaaagaagaaaaagccaaagat
gataagggtaaacagaagttgaggcagcttcatacacatcgatatggggagcctgaggtc
cccgagtcagcattctggaagaaaatcatagcctaccaacagaagctgctgaactatttt
gctcgcaacttttacaacatgagaatgctggccctgtttgtcgccttcgccatcaatttc
atcctgctcttctacaaggtctccacttcttctgtggttgaaggaaaggagctgcctacc
cgaacttccagcgatgccgctaaagtgaccaccagcctggacagcggcccccacagaatc
attgcggttcactacgtcctggaggagagtagcggctacatggaacccaccttgcgcatc
ctagccatcctccacaccatcatctccttcttctgcatcatcggatactactgcctgaaa
gtccccttggttatttttaagcgagagaaggaagtggcacggaagttggagtttgatggg
ctttacattacggagcagccatcggaagacgatatcaaaggccagtgggacagactggtg
atcaacacacagtcatttcccaataactactgggataaatttgttaaaagaaaggtaatg
gataaatatggagagttttatgggagagacagaatcagcgagttactgggcatggataag
gctgcactggatttcagcggtgcaagagagaagaagaagcccaagaaggacagttccttg
tctgctgtattgaactctattgacgtgaagtaccagatgtggaaacttggagtcgtgttc
acagacaattccttcctctacctagcctggtatatgaccatgtctgttcttggacactac
aacaactttttttttgctgcccacctccttgacatcgcgatgggcttcaagaccttgaga
actatcctgtcctcagttacccataatggcaaacagctcgtgttaactgttggcttgttg
gctgtcgttgtatacctgtacactgttgtggcgttcaatttcttccgaaaattctacaat
aaaagcgaggatggtgacacgccggacatgaagtgtgacgacatgctgacgtgttacatg
ttccacatgtatgtgggcgtccgtgctggagggggcatcggtgatgaaattgaagaccca
gcaggagatgagtacgagatctaccgaatcatctttgatatcacattcttcttctttgtg
attgtcatccttttggctatcatacaaggtttgatcattgatgcttttggagaactcaga
gaccaacaagagcaagtcaaggaagacatggagaccaagtgcttcatctgtgggataggc
aacgactactttgatacagtgccgcatggctttgaaacccatactctacaggagcacaac
ctggccaactacctgttttttctgatgtacctcataaacaaggatgaaacagaacacacg
ggacaggaatcttatgtctggaagatgcaccaagagaggtgttgggaatttttcccagca
ggagactgtttccggaaacagtatgaggaccagttaaattaa

DBGET integrated database retrieval system