KEGG   Rattus norvegicus (rat): 689574Help
Entry
689574            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC689574
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4535
Motif
Other DBs
NCBI-GeneID: 689574
NCBI-ProteinID: NP_001182432
RGD: 1591053
Ensembl: ENSRNOG00000046109
UniProt: M0R474
Position
4q22
AA seq 58 aa AA seqDB search
MLQFLLGFTLGNVVGMYLAQNYDINDNIPFFFLKMPNLAKKLEEIKKDLEAKKKPPSS
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagttcctgcttggatttactttgggcaacgtggttggaatgtatctggcccag
aactacgacataaacgataatattcctttcttctttttaaagatgccaaacctggctaaa
aaacttgaagagattaaaaaggacctggaagccaagaagaagccccctagttcctga

DBGET integrated database retrieval system