KEGG   Rattus norvegicus (rat): 689688
Entry
689688            CDS       T01003                                 

Gene name
Atg2a
Definition
(RefSeq) autophagy-related protein 2 homolog A
  KO
K17906  autophagy-related protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    689688 (Atg2a)
   04136 Autophagy - other
    689688 (Atg2a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    689688 (Atg2a)
   05014 Amyotrophic lateral sclerosis
    689688 (Atg2a)
   05016 Huntington disease
    689688 (Atg2a)
   05017 Spinocerebellar ataxia
    689688 (Atg2a)
   05022 Pathways of neurodegeneration - multiple diseases
    689688 (Atg2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    689688 (Atg2a)
   03029 Mitochondrial biogenesis [BR:rno03029]
    689688 (Atg2a)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    689688 (Atg2a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    689688 (Atg2a)
SSDB
Motif
Pfam: ATG_C Chorein_N ATG2_CAD VPS13
Other DBs
NCBI-GeneID: 689688
NCBI-ProteinID: NP_001103015
RGD: 1589890
Ensembl: ENSRNOG00000060707
UniProt: D3ZT64
Position
1
AA seq 1916 aa
MSRWLWPWSNCVKERVCRYLLQHYLGHFFQEHLSLDQLSLDLYKGSVVLRDIHLETWSVN
EVLRSMESPLELVEGFVSSIEVAVPWAALLTDHCTVCVSGLQLILQPRQGSGPEAADSQT
WASCMTTSLQLAQECLREGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLNTVVRVEH
SLGDEERSVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLTGVCLYFEELP
SQVDPPKPPLQIGSCTGYMELMVKLKQNEAFPGPKLEVSGQLGSLHLLLTPRQLQQLQKL
LSAINLADPGGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAESLSLHPITSPLNLDS
ADLFFSMAGLTSSVTSGVSELSVYSVDLGSSVHSNMALHRPSTPTHSGGKTAPTPLLDTM
RPDSLVKMTLGGLSLTLLQTASPSSGSPDLTTHFFAEFDAAKDGPFGSRDFYHLRPRFQR
ACPCSHVRLTGTAVQLSWELRTGGHSRRTSSTEVHFGQLEVLECLWPRAASEPEYTEILS
FPSYSGSEASARPCAHLRHTQTFRRVLKSRSRRSTACHCHSELSLDLADFQADVELGSLD
RLAVLLRQITTPSEPPAGLLTEPPQATEQQTVFRLSAPRATLRLRFPIPDLRPERDPWAG
QAVRTEQLRLELSEPQFRSELNSGPGPPAPTRLELTCLDLQGIYEDGEKPPVPCLRVSKA
LDPRSTEAKYFLPQVVVTLNPQSSGTQWETASEKGRDLELSTESPCELQQPEPSPFSSKR
TMYETEEMVIPGDPEEMRAFQNRTLALSRCTLDVIMPSAHIFLPSKEVYESIYNRINNDL
LMWEPADLLPTSTTAARPPGSSGFKMCKSAFKLDSDSDEEDTQFFSMASGAPQTPAPEPS
HRQSQSTFSTLVTVLKGRITALCEAKDETGKRLDATHGELVLDVEQGTIFSVAQYRGQPG
LGYFCLEAEKATLYHRAAIEDYLLPTHLEVPSFAPPAQLAPTIYPSEEGVTERGTLGRKS
QGPPMLSAAVRIHLDPHKNVKEFLVTIRLHKATLRHYMAPPEQSWHSQLLDFLDVLDDPV
LGYLPPTVITILHTHLFSCAVDYRPLYLPVRVLITAETFTLSSNIVMDTSTFLLRFILDD
SALYLSDKCEVENLDLRRDYVCVLDIDLLELVIKTWKGSTEGRLSQPLFELRCSNNVVHV
HSCADSCALLVNLLQYVTSSGDLHPPPQPPSPTEIAGQKLSESPASLPSCLPVETALINQ
RDLTDALLDTERRSLRELAQSSGGPLPQASPVSVYLFPGERSGAQAPLPPPGGPSHTLGS
CSEAKEHDKEEEGDGDTLDSDEFCILDAPGLGIAPRDGEPIVTQLHPGPIVVHDGHFSQP
LGSTDLLRAPAHFPVPSSRVVLREVSFIWHLYGGRDFGLHPTYRARVGLAGPRVSPSRSS
GPNRPQNSWRTQGGIGRQHQVLMEIQLSKVSFQHEVYPEESAIAGGLDQELDERPLSRQV
LIVQELEIRDRLATSKINKFLHLHTSERLPRRTHSNMLTIKALHVAPTGSVGGPECCLRV
SMMPLRLNVDQDALFFLKDFFTSLAASINPMVPGDTFEAHRETHSRPSSPQEGQSEGTET
ASSPQEAPGSSHSSSDQQPIYFREFRFTSEVPICLDYHGKHVTVDQVGTFMGLLIGLAQL
NCSELKLKRLCCRHGLLGVDKVLGYALNEWLQDIRKNQLPGLLGGVGPMHSVVQLFQGFR
DLLWLPIEQYRKDGRLIRGLQRGAASFGSSTASAALELSNRLVQAIQATAETVYDILSPA
SPISRSLQDKRSSRKLRRGQQPADLREGMAKAYDAVREGILDTAQTICDVASRGHEQKGL
TGAVGGVIRQLPPTVVKPIIVATEATSNVLGGMRNQILPDAHKDHALKWRLEETQD
NT seq 5751 nt   +upstreamnt  +downstreamnt
atgtcacgatggctgtggccatggtcgaactgtgtgaaagagcgtgtctgccgctacctg
ctacagcactacttgggtcacttctttcaggagcacctcagcctggaccagctcagcctg
gatctgtacaagggcagcgttgtcctgcgggatattcacctggaaacctggtctgtgaac
gaggttttgaggtcaatggagtcaccactggaactggtggaaggcttcgtgagctccatc
gaggtggctgtcccctgggctgcacttctcactgaccactgcactgtgtgtgtgtcaggc
cttcagcttatcctgcaaccccgccagggttcagggccagaggctgcagactctcagact
tgggcctcatgcatgaccacaagcctacagctggctcaagagtgccttcgggaagggttg
ccagaaccctcagaaccaccacagcccctagaggggctggaaatgtttgcacagaccatt
gagactgtgctccggaggatcaaggtgaccttcctgaacactgttgtgagggtggagcat
tcactgggtgatgaggaacggagtgtagctgtggaggtccgagtgcagagactggaatac
tgtgacgaagcagtgcgggacccaagccaggcaccacctgtggacgtgcaccagccacct
gccttcttgcacaagctgctgcagctgactggggtctgcctgtactttgaagagctgccc
tcccaggtggacccgccaaagccacctttgcaaatcggcagctgcacagggtacatggag
ctcatggtgaagctgaaacagaatgaggccttcccggggcccaagttggaggtatcagga
cagctgggatccctgcatctgctcttgaccccgcgtcagctccagcagctccaaaaactg
ctcagtgccatcaaccttgcagatccaggaggcctggctgacaagctgaacaagagccgc
ccactaggtgctgaagacttgtggctcattgagcaagatcttaaccagcagctgcaggcg
ggtgcagtggctgagtccctcagcctgcaccccatcaccagccccctcaatttggacagt
gcagacctattcttctccatggctggcctcacaagcagtgtgacctccggtgtctctgag
ctctcagtgtatagtgtagacctgggctcctcggttcacagcaacatggccctccatcga
ccctcaaccccaacccactcaggtggcaagacggctccgactccccttctggataccatg
cgccctgactcactggtgaagatgaccttgggaggtttgagcctgaccttgcttcagaca
gcttccccatcttcaggatcacctgacctcaccacccacttttttgctgagttcgatgct
gccaaagatgggccgttcgggtcccgagacttctaccacctccggccacgcttccagagg
gcctgcccttgtagccatgtccgattaacaggcacagccgtgcagctgtcctgggagctg
cgtactggcggccacagccggaggacaagcagcacagaagtgcacttcggacagctggag
gtgctggagtgcctgtggcccagggctgcctcagagccagagtacacagagatcctgagc
ttccccagttactctggctccgaagcctcagctcggccctgcgcccatctgcgccacaca
caaacctttcgccgggtgctcaagagccggtcccggcgctccactgcctgccattgtcac
tcagaactctccctggacctggctgatttccaagctgacgtggagctggggtcgctggac
cgccttgctgtcttgctccgtcaaatcaccacaccctctgagccacccgctggcctacta
acagagcccccacaggccactgagcagcagacagtgtttcgtctctcagcaccccgggcc
accctgaggctacgcttccccatcccagacttacggcctgaacgggacccctgggctggc
caggctgtacggactgagcagctgcgactggagctgagtgagcctcagttccgctcagag
ctcaacagtgggcctggccccccagctcctacccgcttggaacttacttgcttagaccta
caaggaatctacgaagatggagagaagccacctgtcccctgcctgcgggtctctaaggct
ctggatcccaggagcactgaggccaagtacttcctacctcaggtagtggtgaccctgaac
ccccagtccagtggcacacagtgggagacagcctctgagaaaggccgggatctagaactg
tctaccgagagtccatgtgagctccagcagcctgagccctcacctttctcctccaagcgg
actatgtatgaaactgaggagatggtgatccctggagaccctgaggagatgagggcattc
cagaaccggacgctggcgctgtcccgctgtactctggatgtgatcatgcccagtgcccac
atcttcctgcccagcaaggaggtctacgaaagcatctacaacaggatcaacaatgacctg
ctcatgtgggagcctgcagacctacttcccacatccaccactgctgctcggccgcccggc
tcttctgggttcaagatgtgcaagtcagccttcaagctagactcggattcggatgaagaa
gacacccagttcttctcgatggcatcaggtgccccccagactcctgccccggaaccttcc
catcgtcagtctcagagtaccttctccacactggtgacagtgctgaagggtcggatcact
gcgctctgtgaggctaaggatgagacagggaagcggctggatgccactcacggggagctg
gtactagatgtggagcaaggcaccatcttcagcgtagcccagtaccgtggccagccgggg
ctcggctacttctgcttggaagctgaaaaggcaacactctaccatcgagcggccattgag
gactacctgctgcccactcacttggaagtacccagctttgctcccccagctcagctggct
ccaaccatctacccatcagaggaaggggtgactgagcggggaacattgggccgcaagagc
cagggtccccccatgctgtctgcagctgtccgcatccacctggacccccacaagaatgtc
aaggaatttttggtgacaatacggctgcacaaagccactctacgccactacatggcccct
cctgagcagagctggcactcccagctattggacttcttggatgtactggatgaccctgtg
ctgggttacctgcccccaacagtcatcactattctgcacacacacctcttctcctgtgct
gtggattacaggcccctctacctccctgtgcgtgtccttatcactgctgagaccttcact
ctctccagcaacattgtcatggacacgtcgaccttcctgctcaggttcatcctcgatgac
tccgctctgtacctgtctgacaagtgtgaggtggagaacctggacctgcggcgagattat
gtctgcgtcctggacattgacctcctggagcttgtaatcaaaacctggaagggcagcacc
gagggcagactgagccagccgctgtttgagctgcgctgctccaacaatgtggtgcatgta
cacagctgtgctgactcctgcgccctgctggtcaacctgctccagtatgtaactagctcc
ggtgacctgcatcccccgccccagccccccagccctacggagatcgccggccagaagctt
tcagagagcccggcctccctgccttcctgcctaccagtggagacagccctcatcaaccag
cgagacctgactgatgcccttctggacactgaacggcgtagcctacgggagctggcccag
tcatcaggtggcccacttcctcaggcctctcccgtctccgtctatctgttcccaggtgaa
cggagtggggcccaggcccccttgcctcctcctgggggcccttctcataccttggggtcc
tgttctgaggcaaaggaacatgacaaagaagaggaaggggatggagacaccctggacagt
gacgagttctgcatccttgacgcccctggcctaggcattgcgccccgagacggtgagccc
atcgtgactcagctgcatccaggccccatcgttgtgcatgatgggcacttctcccagccc
ctgggaagcactgacctgctgcgggcgcctgcccacttcccagtgcccagcagccgtgtg
gtactacgggaggtctccttcatctggcacctttatgggggtagagactttggccttcac
cccacttacagagcaagagtaggcctcgcaggccctagggtctcaccttcccgttcctct
ggtcccaaccggccacagaactcctggcgtacccaaggtggcattggacggcaacaccag
gtcctcatggagatccagctcagcaaagtgagcttccaacatgaagtatacccagaagaa
tcagccatagccgggggcctggaccaggaactggatgagcgaccactgtcccgccaggtg
ctcattgttcaggagctagaaatccgagaccggctggccacctccaagatcaacaagttc
cttcatttgcacacgagcgagcggctgccacggcgcacacactccaacatgcttaccatc
aaggcactgcacgtggctcccaccggcagtgtaggagggccggagtgctgtcttcgagtc
tccatgatgcctctgaggctcaatgtggaccaggatgcccttttcttcctcaaggacttt
ttcaccagcctagcagccagcatcaaccccatggtcccaggggacacttttgaggctcac
cgagagacccacagccggcccagcagcccccaggaagggcagtctgagggcacagagaca
gccagcagcccccaggaagctccaggcagtagccacagctcctctgaccaacagcccatc
tacttcagggagttccgcttcacatctgaggtgcccatctgcctggattaccatggcaaa
catgtcactgtggaccaggtgggcactttcatgggactcctaattggcctggcccagctc
aactgctccgagctgaagctcaagaggctttgctgccggcatgggctcctaggtgtggac
aaagtgctcggctatgccctcaatgaatggctgcaggacatccgaaagaaccagctgcct
ggcctgctgggaggcgtgggtcccatgcattcggttgtacaactcttccaggggttccgg
gacctgctgtggctacccatcgagcagtacaggaaagatgggcgcctcattcgggggctg
cagcgtggcgctgcctcctttgggtcatccacagcctctgctgctctggaactgagcaac
aggctggtccaggccatccaggctacagctgagacagtatatgacatcctgtcccctgca
tctcccatctcccgatccctacaagacaaacgttcttcacggaaactacgcagaggtcaa
caacctgctgacctccgggaaggcatggctaaggcatatgacgctgttcgagagggtatc
ctggatacagctcaaaccatctgtgatgtggcatcaaggggccatgagcagaagggactg
acaggtgccgtggggggtgtgatccgacagctccccccaactgtggtaaaaccaataatt
gtagcaacagaggcaacatccaacgtgctagggggcatgcgtaaccagatcctgccagat
gcacacaaggaccatgctctcaagtggcgattggaggagacccaggactga

DBGET integrated database retrieval system