KEGG   Rattus norvegicus (rat): 689704Help
Entry
689704            CDS       T01003                                 

Gene name
Vsx1
Definition
(RefSeq) visual system homeobox 1
  KO
K09335  visual system homeobox protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    689704 (Vsx1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    689704 (Vsx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 689704
NCBI-ProteinID: NP_001103016
RGD: 1305667
Ensembl: ENSRNOG00000042220
UniProt: D3ZQZ0
Position
3q41
AA seq 369 aa AA seqDB search
MTGRDGLLDGRSRSRALAPGCPPTGSRLRSFAINDLLGLEADLPTPAEPGLRSNCEAPAE
ATGPGPGPGLCGTCPARGALPLGLGLLCGFGAQPPSATAARARCLLLADLRLLPPAGPEP
AVAQSPVHPPPALGSQQRSENISTSDGDSPSEEKNDPKMSLTLGKRKKRRHRTVFTAHQL
EELEKAFGEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYG
LYGAMVRHCIPLPDSVLNSADSLQGSCAPWLLGMHKKSTEMRKPESEEKLAGLWELDHLR
KGAKKDEDGPERGPGKASLNPEGSLEDVAIDLSSSSRQETKKMPSGSSTQGCTHAPGPQV
LQPPQVGAS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacgggccgggatgggcttttggatgggcgttccaggagtagagccctggcgccaggc
tgtccccccaccggctctcgccttcgaagcttcgccatcaacgacctgctgggattggag
gcagacctgccgactccagcggagcctgggctaagatccaactgtgaagctccagcggag
gcaacagggccaggaccggggccgggactctgcggcacctgccctgctcgcggagctctc
ccgctgggcctgggcctcctctgcggcttcggggcacagcccccttccgcgaccgccgct
cgcgcacgctgcctactgctcgccgatctgcggcttctgccgcctgcaggacccgagcct
gctgtcgcccagagcccggtccacccgccgcctgcgctcggcagccagcagcgcagtgag
aacatctccacgtcggatggggacagtccatctgaagaaaagaatgacccgaagatgtcc
cttaccctgggcaagaggaagaagcggagacacaggacggttttcactgcccatcaacta
gaagaactggagaaggcgtttggcgaggcccactaccctgatgtgtatgctcgggagatg
ctggctgtgaaaacagagctcccggaagaccggatacaggtctggttccagaaccggagg
gccaagtggcggaagcgagagaagcgctggggtggcagcagtgtgatggctgagtacggg
ctctacggagccatggtgcgtcactgcattccgttgccggactccgtgctcaactctgca
gacagcctgcagggctcctgtgcaccctggcttctggggatgcataaaaagtctacagag
atgaggaaacctgaaagtgaagagaagttggcaggactctgggagttggaccatctcaga
aagggtgctaagaaggatgaggatggacctgagaggggaccaggcaaagcgagcctgaac
cctgagggcagcttggaagatgtggccattgacctgtccagctcttccaggcaggagact
aagaaaatgccctcagggtccagtactcagggatgtacccacgccccagggccgcaggtg
ctccagcccccacaggtgggagcctcatga

DBGET integrated database retrieval system