KEGG   Rattus norvegicus (rat): 689820Help
Entry
689820            CDS       T01003                                 

Gene name
Kmt5a, Pr-set7, RGD1305893, Setd8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  [histone H4]-lysine20 N-methyltransferase SETD8 [EC:2.1.1.361]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    689820 (Kmt5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    689820 (Kmt5a)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.361  [histone H4]-lysine20 N-methyltransferase
     689820 (Kmt5a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     689820 (Kmt5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET ArlS_N
Motif
Other DBs
NCBI-GeneID: 689820
NCBI-ProteinID: NP_001233594
RGD: 1587560
Ensembl: ENSRNOG00000001062
UniProt: D3ZEB9
Position
12q15
AA seq 322 aa AA seqDB search
MVERRGPGRPRSDGENVFAGQSKIYAYMSPNKCSGMRSPLQEENSVAHHEVKCPGKPLAG
IYRKREEKRNAGNVIRSAVKSEEQKSKDTRRGPLAPFPNQKPEATEPPKTPPPSCDSTSV
AVAKQALKKPLKGKQAPRKKSQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKKIDELI
ESGKEEGMKIDLIDGKGRGVIATKRFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGC
YMYYFQYLSKTYCVDATQETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGE
ELLYDYGDRSKASIEAYPWLKH
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcggaggggcccggggaggccccgcagcgacggggagaacgtgtttgctggg
cagtcaaagatctatgcctacatgagtccgaacaaatgctctggaatgcgttctccactg
caggaagagaactccgtcgcacatcatgaggtcaaatgcccggggaaaccattggccgga
atctacaggaagcgagaagagaaaagaaacgctgggaatgttatccgaagcgctgtgaag
tcagaagaacagaagagcaaagataccaggagaggtcccctggcgccttttccaaaccaa
aaacctgaagcaacagaacctccaaaaactccacccccgtcatgtgattctaccagtgta
gcggttgctaagcaagccctgaaaaagcccctcaagggcaagcaggcccctcggaagaag
tctcaagggaagacacagcagaatagaaaactcacagatttctaccccgtgcgaaggagc
tccaggaagagcaaagctgagctgcagtctgaagaaaggaagaagatagatgagctaatt
gagagcgggaaggaagagggcatgaagattgatctaatcgatggcaaaggcaggggtgtg
attgctaccaagcgattctcccggggagactttgtggtagaataccatggagacctcatt
gaaatcaccgatgccaagaagcgggaggctctgtatgcacaggacccctccacgggctgc
tacatgtactattttcaatatctgagcaaaacctactgcgtggatgccactcaagaaacg
aaccgcctggggagactgatcaatcacagtaagtgtgggaattgccagaccaaactgcat
gacatcgacggcgtgcctcacctcatcctcatagcctcccgagacattgcggccggggag
gagctcctgtacgactatggagaccggagcaaggcctccatcgaagcctacccttggctg
aagcactaa

DBGET integrated database retrieval system