KEGG   Rattus norvegicus (rat): 689830Help
Entry
689830            CDS       T01003                                 

Gene name
Anxa9
Definition
(RefSeq) annexin A9
  KO
K17090  annexin A9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    689830 (Anxa9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 689830
NCBI-ProteinID: XP_001072193
RGD: 1587550
Ensembl: ENSRNOG00000021134
UniProt: D3ZSA0
Position
2q34
AA seq 344 aa AA seqDB search
MSVSCGPLGTSLTQEILRSLGLADKTAAWGTLGTLRTFLSFSVDKDVQRLLKAIAGQGVD
CSTIVDVLTNRSREQRQLISRAFQERTKQDLLKSLQAALSGNLEKIVVALLQPAAQFDAQ
ELRTALKTSGSAEDVALEILATRAAPRLQECLAVYKHDFQVEAEEDLRTETNGILQDLLL
ALSKGARESYSGVIDYNLEEQDVQALQQTGEPSAGQWVLLFTQRSPEHLIRVFDLYRRCT
GQELEDAIRNCFHGDAQRALISLASMMRNTALYFANKLHQALQETEPNFRVLMRVLISRS
ESDLLSIRAEFKKKFGKSLYSSLQDAVGGDCRSALLALCRAEDI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgagctgtggaccactgggaacctctctgactcaggagatcctcagatccctg
ggccttgccgacaagactgcggcctggggaaccctgggcaccctcaggacgttcttgagc
ttcagtgtggacaaggatgtacaaagactgctgaaggccattgcaggccaaggtgtggac
tgcagtaccattgtggatgtactgaccaatcgcagcagagagcaaagacagctcatttct
cgagccttccaagagcgcaccaaacaggatctattgaagtccttgcaggcagcactctct
ggcaacctggagaaaatcgtggtggctctcctacagcctgcagcccaatttgatgcccag
gagttgaggacagccttgaagacctctggttctgctgaagatgtagccttggaaatcctg
gccacccgagcagcaccccgactgcaggagtgcctggcagtgtataaacatgatttccag
gtggaggctgaggaagatctcaggactgagaccaatggcatcctgcaggacctgcttctg
gccctgagcaagggggctcgtgagagctactctggagtcattgattacaacttggaggaa
caagatgtgcaggccctccagcagactggagaacccagtgcaggtcaatgggtcctgctc
tttacacagcgcagtcccgaacacctcatccgagtgtttgatctgtaccggagatgcact
ggccaagaactggaggatgctatccggaactgtttccatggagatgcccagcgggctctg
atcagcctagcttccatgatgagaaacacagcactgtactttgctaacaaactccaccaa
gccctccaggaaactgagcccaatttccgagtgctgatgcgggtccttatctcccgaagc
gagagtgaccttctaagcattcgggctgagttcaagaagaaatttgggaagtctctctat
tcttctctccaggatgcagtcggaggggactgtcgttcagccctcctggccctgtgtaga
gcagaagacatctga

DBGET integrated database retrieval system