KEGG   Rattus norvegicus (rat): 689972Help
Entry
689972            CDS       T01003                                 

Gene name
Piwil4
Definition
(RefSeq) piwi-like RNA-mediated gene silencing 4
  KO
K02156  aubergine
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    689972 (Piwil4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    689972 (Piwil4)
   piRNA pathway
    689972 (Piwil4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi PAZ ArgoN ArgoL1
Motif
Other DBs
NCBI-GeneID: 689972
NCBI-ProteinID: NP_001258062
RGD: 1311015
Ensembl: ENSRNOG00000009043
UniProt: F1LQ32
Position
8q12
AA seq 832 aa AA seqDB search
MSGRARVRARGITTGHSAREVERAPRDLMVSASVYELGVSSGDGRRTLVEKRGNGRQDFV
DLGVCTREKLTHVKDSKTGSSGIPVQLATNLFHLDLPQDWQLYQYHVTYSPDLASRRLRT
ALLYNHSILSDKAKAFDGTSLFLSEKLDHKVTELTSETQRGETVKITLTLTSELFPNSPM
CIQFFNVIFRKIFKKLSMYQIGRNYYKPSEPVEIPQYKLSLWPGFAISVSRFESKLLFNA
DVNYKVLRNETVLEFMTDLCLRTDMSCFTETCHKQLVGLIVLTRYNNKTYRIDDIDWSVK
PTHAFQKRDGSETTYVDYYKQQYDITLSDLNQPVLVSLLKRRRNDNSEPQMVHLIPELCF
LTGLTSQATSDFRLMKAVAEETRLSPMGRQQQLARLADDIQRNQVTRFELETWGLHFGSQ
LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSEPLNTWLIVCCSRAEHLIES
FLSCLRRVGGSTGFSVGHPKIIKVDENPAAFLRAIQLHVNPDVQLVMCILPSNQKNYYDS
IKRYLSSDCPVPSQCVLTRTLNKQGMMLSVATKIAMQMTCKLGGELWAVEIPLKSLMVVG
IDICRDALSKDVAVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNKWYKHN
HDLPARIIAYRDGVGNGQLKAVLEYEVPQLLSSVTECGSDARSCRLSVVVVRKRCLLRLF
AESGHTLQNPPLGTVVDSEATRPEWYDFYLTSQTANRGTVSPTYYNVIYDDNALKPDHMQ
RLTFKLCHLYYNWQGVISVPAPCQYAHKLTFLVAQSIHKEPSLELANKLFYL
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacgggcccgtgtgagggcgcgaggcatcaccactggccacagtgccagggaa
gtggagcgggccccaagagacctcatggtgagtgcttctgtctatgagcttggcgtctct
tctggtgatggtagacgtactctcgtggaaaaaagaggcaatggcagacaggacttcgtc
gatttgggtgtctgtaccagggagaagttgactcacgtaaaagattctaaaacaggttct
agcggaatacctgtgcagctggctacaaatctcttccatttagatttgccccaggattgg
cagctataccagtaccatgtcacatacagcccggatttagcctctaggaggctgaggact
gctctgctgtataaccacagcatactctccgacaaggcaaaggcattcgacggcaccagc
cttttcctctcagaaaagctggaccacaaagtcacagaactgacaagtgaaacccaaaga
ggggagactgtgaagataactctcaccctgaccagtgagctgttcccaaactccccgatg
tgcattcagtttttcaatgtcatcttcagaaagatctttaaaaagttgagcatgtaccag
attggacggaactactataagccttcagagccagtggagatcccccagtacaaattgtcc
ctgtggcctgggtttgccatttctgtgtctcgctttgaaagcaaactcctgttcaatgct
gacgtaaactataaagtcctccgcaatgagactgttctggaattcatgactgatctctgc
ctcagaaccgacatgtcatgcttcactgagacgtgccacaaacagctagtggggctcatt
gtccttaccaggtacaacaacaaaacatatcgtatcgatgacattgactggtctgtgaag
cccacacatgcctttcagaagcgggatggctcagagaccacgtatgtggattactacaag
cagcaatatgatatcaccttatctgacctaaatcagccagtgcttgtcagtctgttgaaa
agaaggagaaatgataactccgagcctcagatggtccacctgatcccggagctctgcttt
ctcacgggcctgaccagccaagcaacctcagacttccgcttgatgaaggcagtcgctgaa
gaaactcggctcagtcctatgggaaggcagcagcaactagcccgactggcagatgacatc
cagagaaaccaagtgactcggtttgagcttgagacctggggattgcattttggaagccag
ctatccctgaccggccgggttgttccctctgaaaagatcctgctgcaggaccacacatgt
caacctgcatttgctgctgattggtccaaagatatgcgatcttgcaaggttctgagttct
gagcctttgaatacatggttgatcgtgtgctgtagcagggctgagcatttgattgaatcc
ttcctgagctgtctgaggagagttggaggttccacgggattcagtgtgggccacccaaaa
atcataaaagtggatgaaaaccctgcagcgttccttcgagccatccagctgcacgtcaac
cccgatgttcagttggtgatgtgcatcctgccttctaatcagaagaactattacgactcc
attaaaagatatttgagctccgactgcccggtcccaagccagtgtgtgctgacccggacc
ttgaacaaacagggaatgatgctgagtgtggccaccaagatcgccatgcaaatgacctgc
aaactcgggggcgagctgtgggctgtggagatcccattgaagtcactgatggtcgtgggc
atcgacatctgtagagacgccctcagcaaggatgtagcggtcgtcgggtttgtcgccagc
attaactccaggatcaccaggtggttttcccgctgtgtcctccagagaacggcagctgat
attgcagattgcctgaaagtctgcatgactggtgctctcaacaagtggtacaaacacaac
cacgatttgccggcacggataatcgcgtaccgggatggtgtgggcaacggccagctaaag
gcagttttggaatacgaagtcccacagctgctgagcagtgtgacagaatgtggctccgac
gccaggagctgtagactgtcagtggtcgtggtcaggaagaggtgtctgctgcgtctcttt
gccgagtctggccatacgctacagaaccccccacttggcactgtcgtggactcagaagca
acacgtccagagtggtatgacttctacctgaccagccagactgctaaccgggggactgtt
agtcccacctactacaatgtcatctatgacgacaacgctctgaagcctgaccatatgcag
cggctgaccttcaaactgtgccacctctactacaactggcagggcgtaatcagtgtccct
gctccgtgccagtatgcacacaagctgaccttcctggtggcacaaagcatccacaaggaa
ccaagtctggaattagccaataagctcttctacctgtga

DBGET integrated database retrieval system