KEGG   Rattus norvegicus (rat): 690005Help
Entry
690005            CDS       T01003                                 

Gene name
Zcchc3
Definition
(RefSeq) zinc finger CCHC-type containing 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC DNAPolymera_Pol zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 690005
NCBI-ProteinID: XP_001072887
RGD: 1585203
Ensembl: ENSRNOG00000007520
UniProt: D3ZZ10
Position
3q41
AA seq 400 aa AA seqDB search
MATGSGAEEEPQRGRPELPLPARPVARAEESEGVREKMGWAQVVKNLAEKKGDFREPRRR
DEAGSGASGGLGSSGSLAAPNPGDFPPAARGDPKGRRRDPTGEAADAYRKKGASSAGDPS
RRKKADVSAAMPTPARSGATEDATERPLQDEPPAAGPGKGRFLVRICFQGDESACPTRDF
VVGALILRSIGMDPDDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKRELEDCWENFV
VLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIEL
RQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGTCTQDRCFRCGEEGHLS
PYCRKVIVCNLCGKRGHAFAQCPKAVHNSMAAQLTGLAGH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggcagtggagcggaggaggagccacagcggggtcggccggagctcccgctc
cccgcgcgccccgtggcccgcgccgaggaatccgagggcgtccgcgagaagatgggctgg
gcccaggtggttaagaacctggcggagaagaagggcgacttccgcgagccgcggcggcgc
gacgaagcaggcagcggtgcgagtggcgggctcggcagctccgggagtctggccgccccg
aaccccggcgacttcccacctgcggctcgcggggacccaaagggccgccgcagagaccct
acgggtgaggcggcagacgcttacaggaagaagggcgcgagcagcgcgggagacccgagt
cgaaggaagaaggccgacgtgtcggcggccatgccgacccccgccaggtccggcgcgacc
gaagatgcaaccgagcggccgctacaggacgagccaccggctgctggcccgggtaagggc
cgcttcctcgtgcgcatctgtttccagggagacgagagtgcgtgtccgacccgggacttc
gtggtgggtgcgctcatccttcgctccatcggcatggaccctgacgacatctacgcagtc
attcagatccccggcagccgtgagttcgacgtgagcttccgatccgcagaaaaactagcc
ctgtttctccgcgtctacgaggagaagcgagagctggaggactgctgggagaactttgtg
gtcttggggcggagcaagtccagcttgaagaccctcttcatcctcttccggaacgagacc
gtggacgtggaggacatcgtgacctggctcaagcgacactgcgacgtgctggccgtgccc
gtgaaagtgaccgacaggtttgggatctggaccggggagtacaagtgtgagatcgagctg
cgccagggggagggcggagtgaggcacctgcccggggccttcttcttgggagcggagagg
ggctacagttggtacaaggggcagcccaagacgtgctttaagtgtggttcccggacccac
atgagcggcacctgcactcaggacaggtgtttcaggtgcggggaagagggacacctgagc
ccttactgccggaaggtcatcgtgtgcaacctctgtggcaaaagaggacacgcctttgcc
cagtgtcccaaagcagttcacaattccatggcagctcagctcaccggcttggcgggacac
tga

DBGET integrated database retrieval system