KEGG   Rattus norvegicus (rat): 690026
Entry
690026            CDS       T01003                                 

Gene name
Hils1
Definition
(RefSeq) histone linker H1 domain, spermatid-specific 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Linker_histone Ets
Other DBs
NCBI-GeneID: 690026
NCBI-ProteinID: NP_001103035
RGD: 1585185
Ensembl: ENSRNOG00000024041
UniProt: D3ZZW6
Position
10q26
AA seq 169 aa
MSLVSPSPDSNAVMAGDQDASTSQVPSQSESKIGPNVATQTLRKPTMSKVILRTVADKGV
HSRVSLAALKKAVSITGYNMAQNTWRFKRVLQNLVKKGMLKQVTGKGASGSFRLGKKQAF
KSKCKAKRRQRRQKPGQRRTGSRRSLLGSKKSNNRLFKGVRRVAKGRRH
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtcgctggtgtcaccatctccagactcaaatgctgtgatggctggagaccaagatgcc
agcacatcacaggtcccaagccagagtgagagcaagattgggcccaacgtcgccacccaa
accctgcggaagcccaccatgtcgaaggtgattctgaggactgtggctgataagggggtt
catagccgtgtgtcccttgctgccttgaagaaagctgtgtctatcacagggtacaatatg
gcccaaaacacctggcgcttcaagcgtgtgctccagaatctagtcaagaaaggcatgctc
aagcaggtgaccggcaagggtgcctcgggctccttccgcctgggcaagaagcaggccttc
aagtccaagtgcaaggccaagagacgccagcggaggcagaagcctgggcagcgccggact
ggatcacgccgatcactactaggctccaaaaagagcaataaccggcttttcaaaggagtt
cgtagggtggctaaaggccgccgccattaa

DBGET integrated database retrieval system