KEGG   Rattus norvegicus (rat): 690043Help
Entry
690043            CDS       T01003                                 

Gene name
Rnf168
Definition
(RefSeq) ring finger protein 168
  KO
K20779  E3 ubiquitin-protein ligase RNF168 [EC:2.3.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    690043 (Rnf168)
   03400 DNA repair and recombination proteins [BR:rno03400]
    690043 (Rnf168)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     690043 (Rnf168)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    690043 (Rnf168)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     690043 (Rnf168)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4 zf-C3HC4_2 Prok-RING_4 zf-C3HC4_3 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 690043
NCBI-ProteinID: NP_001121069
RGD: 1585168
Ensembl: ENSRNOG00000043345
UniProt: B2RYR0 A0A140TA93
Position
11q22
AA seq 566 aa AA seqDB search
MKMAAPKNSIPSLAECQCGICMEILVEPVTLPCNHTLCNPCFQSTVEKANLCCPFCRRRV
SSWTRYHTRRNSLVNTDLWEIIQKHYAKECKLRISGQESKEIVDEYQPVRLLSKPGELRR
EYEEEISKVEAERQASKEEENKASEEYIQRLLAEEEEEEKRRTERRRSEMEEQLRGDEEL
ARRLSTSINSNYERNILASPLSSRKSDPVTNKSQKKNTNKQKNFGDIQRYLSPKSKPGTA
WACKTEHGEDMCKSKETDSSDTKSPVLQDTDVEESMPTHSPQTCPETQGQGPEPLTEMPV
PWLCARNAEQCLEGKAEAVSTNPDDSCIVNDGGPRAIVSNSKEAAVKPPTKIENEEYSVS
GVTQLTGGNGVPTESRVYDLLVGKEISERENQESVFEEVMDPCFSAKRRKIFITSSLDQE
ETEVNFTQKLIDLEHMLFERHKQEEQDRLLALQLQKEADKEKMVPNRQKGSPDQYQLRTS
SPPDGLLNGQRKNVKDRNSPKQTADRSKSQRSRKGEYWETFESTWKGSVNGTKMPTPRKD
SCNVSKRACPLQHRSAQKSILQMFQR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggctgcacctaaaaactccatcccttccttagcggaatgtcagtgcgggatc
tgcatggaaatcctcgtagagcctgttaccctaccttgcaaccacacgctctgtaaccca
tgcttccaatcgactgttgaaaaggccaatttatgctgtcccttctgtcgccgccgggtc
tcttcgtggactcggtaccatacccgaagaaattctctggtcaatacagacctgtgggag
attattcaaaagcactatgcaaaggaatgcaagcttagaatctctggacaagaatcaaag
gaaatcgttgatgagtaccagccagttcgtctactcagtaaacctggggagttgaggcga
gaatatgaagaggagataagcaaggtggaggctgagcgacaagccagcaaggaagaggaa
aacaaagccagtgaggagtacatacagagactgctggccgaggaggaggaggaggagaaa
aggcggacggagagaagacgaagtgagatggaggagcagctgaggggcgatgaggagctg
gcgaggaggctgagcaccagcatcaacagtaactacgagagaaatatcttggcatctcct
ttgagttccagaaaatcagatcccgtcacaaacaagtcacagaagaaaaatacgaacaaa
caaaaaaactttggagatattcaaagatacttgtcacctaagtcaaagcctgggacagca
tgggcatgtaaaactgagcatggagaagacatgtgcaagtctaaggaaacagacagtagt
gacacgaagagccctgtgttgcaagacacagacgttgaagaaagcatgccaacacattct
cctcagacctgcccagaaactcaagggcaaggtccggagcctttgacagagatgcctgtg
ccatggctatgtgcaaggaatgctgaacagtgccttgagggaaaagctgaagcagtgtca
accaatcctgatgattcatgtattgtaaatgatggtggacctagagccatagtttctaac
tctaaggaagctgcagttaagcctcctaccaagatagaaaacgaagagtattctgtgtca
ggtgtgacccagttaactgggggcaacggagttccaacagagagcagagtgtacgactta
ctagtcggaaaagagatttccgaaagagaaaaccaggaatctgtgtttgaagaagtcatg
gatccatgcttttctgcaaaaagaaggaaaatattcatcacatcctccttagatcaagaa
gaaacagaagtgaattttacacaaaaactgatagatttggaacatatgcttttcgagaga
cataagcaagaagaacaggacaggttgttagcattacaacttcaaaaagaggcagataaa
gaaaaaatggtgccaaaccggcagaaaggatccccagatcagtaccagctgcgcacatct
tcacccccagacgggttgctgaatggacagaggaagaatgtcaaagataggaactcccca
aagcaaactgcagatcgttcaaaatctcagaggagcaggaaaggtgaatactgggagacc
ttcgaaagcacttggaagggttcagttaatggaacgaagatgccaactcctaggaaagat
agttgtaatgtatctaaacgtgcctgtcccctacagcacagaagtgcacagaaaagcatt
cttcaaatgtttcagaggtaa

DBGET integrated database retrieval system