KEGG   Rattus norvegicus (rat): 690229
Entry
690229            CDS       T01003                                 

Gene name
Wdr74
Definition
(RefSeq) WD repeat domain 74
  KO
K14841  ribosome biogenesis protein NSA1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    690229 (Wdr74)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    690229 (Wdr74)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 690229
NCBI-ProteinID: NP_001103039
RGD: 1582881
Ensembl: ENSRNOG00000042878
UniProt: D3ZMQ7
Position
1q43
AA seq 366 aa
MAATSARWNHVWVGTETGILKGVNLQRKLAANFTPSGQPRREEAVNALCWGTGGETQILV
GCADRTVRHFNAEEGTFQSQRYCPGGEGTFRGLAQADDGTLITCVDSGILRVWCENDKEA
SSDPLLELKVGPGVCRMRQDPTHTHVVATCGKENALKVWDLQGSEEPVFRAKNVRNDWLD
LRVPIWDQDIQFLPGSQKLVTCTGYHQVRIYDPASPQRRPVLEATYGEYPLTAMTLTPEG
NSVIVGNTHGQLAEIDFRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIR
NPRGLEHKDEPQEPQEPNLVPPEDTETDELWASLEAAAKRKLPDLDQKQGALQRRKKKKR
PGSTSP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggccgctacctcggctcgctggaaccatgtgtgggtcggcactgagactggaatcctg
aaaggggtgaaccttcagcggaaacttgcggcaaattttactccgtccggacagccacgg
cgggaggaggcagtgaatgctttgtgctggggcacaggcggcgagacccagattttggtg
ggatgtgcggacaggaccgtgaggcactttaatgcggaggagggtacattccagagccag
agatactgcccaggcggggaaggcacgttccgaggtctcgcccaggccgatgatggcact
cttatcacatgtgtggattctgggatcctcagagtctggtgtgaaaatgacaaggaggcg
tcctctgacccactcttggaactgaaggtgggtcctggggtgtgtaggatgcgccaagat
cccacacacacacatgtggttgcaacatgtgggaaagagaatgctttgaaagtatgggac
ctacaggggtctgaggagcctgtgttcagggcgaagaatgtgcggaatgattggcttgat
ctgcgggttccgatttgggaccaagatatacagttcctccctgggtcacagaaacttgtc
acatgtacaggataccaccaggtcagaatctatgatccagcctccccccagcgccggcca
gtcctagaggccacctatggagaatacccactgacagccatgaccctgactcctgagggc
aattctgtcatcgtggggaacactcatgggcagctggcagaaattgattttcggcaaggg
cgtctactgggctgtctgaaggggcttgcaggcagtgtacgtgggctgcagtgtcatcct
tcgaagcccctgttagcatcttgtggcttagacagagtcctgaggatacacaggatccgc
aatccacgagggctagagcataaggatgagccccaagaacctcaagagcccaacctagtg
cccccagaagacacagagacagatgaactttgggcgtctttggaggcagctgccaagcga
aagctccctgatttggaccagaaacaaggtgctctccaaagaaggaagaaaaagaagcgt
cctggatccaccagtccttga

DBGET integrated database retrieval system