KEGG   Rattus norvegicus (rat): 690345
Entry
690345            CDS       T01003                                 

Gene name
Srp9
Definition
(RefSeq) signal recognition particle 9 kDa protein
  KO
K03109  signal recognition particle subunit SRP9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    690345 (Srp9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    690345 (Srp9)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   690345 (Srp9)
SSDB
Motif
Pfam: SRP9-21 VirD1
Other DBs
NCBI-GeneID: 690345
NCBI-ProteinID: NP_001119567
RGD: 1597343
Ensembl: ENSRNOG00000003211
UniProt: D4A511
Position
13
AA seq 86 aa
MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVK
KIEKFHSQLMRLMVAKESRSVAMETE
NT seq 261 nt   +upstreamnt  +downstreamnt
atgcctcagttccagacctgggaggagttcagccgcgcggctgagaagctctacttggcg
gaccccatgaaggtacgtgtggttctcaagtacaggcatgttgatgggaatttgtgtatc
aaagtgacggacgatctagtctgtttggtgtacagaacagaccaagctcaagatgtaaag
aagattgagaaattccacagtcagttaatgcgacttatggtggccaaggaatcccgcagt
gtcgctatggaaacagaatga

DBGET integrated database retrieval system