KEGG   Rattus norvegicus (rat): 690368
Entry
690368            CDS       T01003                                 

Gene name
Tmem253
Definition
(RefSeq) transmembrane protein 253
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CD20 IncE
Other DBs
NCBI-GeneID: 690368
NCBI-ProteinID: XP_006221991
RGD: 1597322
Ensembl: ENSRNOG00000039489
UniProt: D4ACQ1
Position
15p14
AA seq 204 aa
MDQNVDQPRQEEPSLRLEKLQHWAKRRHSGHLLVLAVSQLWLAIAVVPFTLSVSCLNSAC
HLATVLPLWPGASGLLTGIVTLEFRRAPCIWKVRAMMISNTLNLILGFIAVVMEVIKTAL
GTASADSSQSTGLLVLELSAEAFTLGGVLFSTYALFLLSQRKPGSFKKSRLQYQELQEGL
SEVEEVSGLENDPVVASTGNRTEE
NT seq 615 nt   +upstreamnt  +downstreamnt
atggatcaaaatgttgatcagccaaggcaggaggagcccagccttcgcctggaaaaacta
caacactgggcaaaacgcaggcacagtggacatctactggtgctggcggtgagccaacta
tggctggcaatagctgtggtcccctttactctctcggtttcctgcttgaactctgcctgt
cacctggccacagtgctgccactttggcctggagcctcgggtctcctcactggcatcgtt
acccttgaatttcgaagagcaccttgcatctggaaggtgcgggccatgatgatatccaac
accttgaacctgatcttgggcttcattgcggtggtgatggaggtgatcaagacagccttg
gggactgcctctgctgactcctcccagtcgacagggttgctggtgctagagctcagcgcc
gaggccttcaccctagggggagtgctgttctcaacatacgctctattcttgctgagccag
aggaagcctggatccttcaagaagtcaaggctgcagtaccaggagctacaggagggtctc
tctgaggtggaggaggtttctggtttggagaatgatcccgtggtggctagcacaggaaat
agaacggaggagtga

DBGET integrated database retrieval system