KEGG   Rattus norvegicus (rat): 690423Help
Entry
690423            CDS       T01003                                 

Gene name
Jsrp1
Definition
(RefSeq) junctional sarcoplasmic reticulum protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: JSRP
Motif
Other DBs
NCBI-GeneID: 690423
NCBI-ProteinID: NP_001103061
RGD: 1596084
Ensembl: ENSRNOG00000032951
UniProt: D4A2V6
Position
7q11
AA seq 338 aa AA seqDB search
MTTRGLEDLDGGLGSCIPSDDLPFLEESPSGRRPDSKTRGTSRLSDSSSWSHVLQDPVTA
GAGDAGLKKTEKERMGKESAPAGKAGASPRSIPARRKPQAAPPLQPPLPPSDDELPWGDL
TLNKCLVLASLLALLGSAFQLCRDAVAGEAVAAPQQWVPPSSPTKKPASPTPAPAPAPKP
PVLVPPSGPPQPKPGPPAPQAEMRDEPELPGSPEAAETQAEPGGSISEASGEESAPLGDR
GSQEKPQKEKPRKGEKPKKEKPRREKPRREEKPQVTREPRQSLRQRWEAREGGHRPWRRD
SRDLEHGKLKAWAPRRRHDQHDRDNRPRQRPRVGKRHD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccagaggcttggaggatctagatgggggcctgggcagctgcatccccagtgat
gatctcccattcctagaggagtccccctcaggccggcggccagacagcaagactcgaggg
acatccaggctttcggactccagcagctggagccatgtccttcaggacccagttaccgct
ggcgctggcgatgccgggctcaagaagacggagaaagagcgcatgggcaaggagagcgca
ccagcaggcaaagctggagcaagcccccggagcattcctgcgcgtaggaagccgcaggct
gcgcctcccttgcagccacccctgccgccaagcgacgacgagttgccctggggagatctg
acgctcaacaagtgcctggtgttggcctcactgctggccctgctgggctcggctttccag
ctatgtcgggacgcagtggctggggaggccgtggcggcccctcagcagtgggtcccgccc
agctctccaaccaagaagccagcgtcgccaacgccagcgccagcgccagcccctaaacct
ccggtgttggtgcccccatccgggcctcctcagccgaagcctgggccacctgcaccccag
gcagagatgagggatgagcctgagcttcccgggagccctgaggctgcagaaacccaggca
gaacctggagggtccatctcggaagcctctggggaggagagcgcaccccttggtgaccga
ggttcccaggagaagccacagaaagagaagccaaggaaaggggagaaaccgaagaaggag
aagccaagaagggagaagccgaggagggaggagaagcctcaggtcactagggagccccgc
caatcactgagacagcgctgggaggcgcgggaaggaggccatcggccatggaggcgggac
tccagggacctcgagcatgggaagctgaaggcctgggctcctcggcgacggcatgaccag
catgatcgtgacaaccggcccagacagaggccccgtgttgggaagaggcatgactga

DBGET integrated database retrieval system