KEGG   Rattus norvegicus (rat): 690441
Entry
690441            CDS       T01003                                 

Gene name
Atp5j2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
  KO
K02130  F-type H+-transporting ATPase subunit f
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    690441 (Atp5j2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    690441 (Atp5j2)
SSDB
Motif
Pfam: WRW F1F0-ATPsyn_F
Other DBs
NCBI-GeneID: 690441
NCBI-ProteinID: NP_001258046
RGD: 1596067
Ensembl: ENSRNOG00000027049
Vega: OTTRNOG00000000687
UniProt: D3ZAF6
Position
12p11
AA seq 88 aa
MASIVPLKEKKLMEVKLRELPSWILMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGI
NMVLAAYVVFSYCISYKELKHERRRKYH
NT seq 267 nt   +upstreamnt  +downstreamnt
atggcgtctatcgtgccattgaaggagaagaagctcatggaggttaaacttagagagctg
ccaagctggatattgatgcgggatttcacccccagtggtattgcaggagcctttcggaga
ggctatgaccggtattacaacaagtacatcaacgttcggaaaggcagcatctcagggatt
aacatggtgctggcagcctacgtggttttcagctactgcatttcttacaaggaactcaaa
cacgaacggcgacgcaagtaccactga

DBGET integrated database retrieval system