KEGG   Rattus norvegicus (rat): 690450Help
Entry
690450            CDS       T01003                                 

Gene name
Taf1b, TAFI63
Definition
(RefSeq) TATA-box binding protein associated factor, RNA polymerase I subunit B
  KO
K15213  TATA box-binding protein-associated factor RNA polymerase I subunit B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    690450 (Taf1b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   Basal transcription factors
    SL1/TIF-1B
     690450 (Taf1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RRN7 NOB1_Zn_bind
Motif
Other DBs
NCBI-GeneID: 690450
NCBI-ProteinID: NP_001178036
RGD: 1596058
Ensembl: ENSRNOG00000061415
UniProt: D3ZYB7
Position
6q16
AA seq 586 aa AA seqDB search
MDVEQMKAFTDRCSQCAAVSWGLTDEGKYYCTSCHNVTDRSEEVVSTAVIPNTKINSISR
GLRQRSKHEKGWDWYVCEGFQCILYHQAEALETLGVSPELKNEVLHSFWKRYLQKSKQAY
CKNPVRTSGRKAKVLEDNLQSSDWGSDFELLSDTTCPPESGAEFQSDSQTPKPFPATKRS
SKSASVCSGSVDGVEYSERKEKGLLKMTVPRTLALCYLSLLWQRETITLSDLLRFVEEDR
IPYINAFKVFPEEMKVYGRDKGIFAVESWPDYEDIYKNMIEVAVFLDLPRFPDITEDCYL
HPNTLCMKYLLEVNLPEEMYTLTCQVVKLTGIGEVDFLTFDPIAKMTRTVKHDVQAVAVI
VLVLKLLFLLDDKLEWSYSDLAEAYNEGHKEETPQFDFRKWYQVMKKTFDEKRRKWEEAR
AKYVWKTKRPLYRSHIDKSVAYKRREMVENLQKQFSALIGSAPEVERQAPSSFQLNWTGE
DTGSPCFHGHSLQGLLISKGQALITKNSLYWLSTHKFCKSYCKHVTTYEESNFSLSYQFI
LNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKRSSRSKKVRRH
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggagcagatgaaagcattcacagaccgctgttctcagtgcgccgctgtctcc
tggggccttactgatgaaggcaaatactattgtacctcctgccacaatgtcacagatcga
tccgaggaagtcgtgagcactgcagttatccctaacaccaagatcaactccattagcagg
ggcctgagacagagaagcaagcatgagaaaggctgggattggtacgtgtgtgaaggcttc
cagtgcatactttatcaccaagcagaagccctggagaccctcggagtaagcccagaacta
aagaatgaagtcttgcacagtttttggaagcgctaccttcagaagagcaagcaggcctat
tgtaaaaacccagttcgcacaagtggaaggaaagccaaggtattagaagacaatctgcag
tcctctgactggggcagtgattttgagttgctcagtgacaccacatgtcctcctgaaagt
ggagcagagttccagtctgactcccagactccaaagcctttccctgccaccaaacgatca
tcaaagtcagcatccgtctgttctggatctgttgatggagtggagtactcagagcggaag
gagaaggggctcctgaagatgactgtgcccaggacacttgccctctgctatctgtccttg
ctctggcagagagaaacaattacactttcagaccttttgaggtttgttgaagaggaccgt
attccatacataaatgcttttaaggtttttccagaggagatgaaagtatatggtcgtgac
aaaggcatctttgctgtcgagtcttggcctgactatgaagacatctataaaaacatgatt
gaagtcgccgtgtttttagatttgcctcgtttcccagacataactgaagactgctacctc
catcccaacaccttgtgtatgaaatacttactggaggtcaatctccctgaggaaatgtac
actttaacctgccaagtagtaaagctgactggaattggagaagtagattttctgacgttt
gaccctatagctaaaatgacaaggacagtcaaacatgatgtgcaggctgtggctgtcatc
gtgcttgtgttgaagctgctgtttctgctggatgacaagctggaatggtcttactcagat
cttgctgaagcatataacgaaggacacaaagaagaaactccgcagtttgatttcagaaaa
tggtaccaagttatgaagaaaacttttgatgagaaaagacgaaaatgggaagaagcaagg
gccaagtatgtttggaaaaccaaaaggccactctaccgttcacacattgataagtcagtc
gcatataagagaagagaaatggtggagaatcttcagaaacagtttagtgccctgattggt
tcagcacccgaggtggaaaggcaggccccttcaagttttcagctcaactggactggagaa
gacaccggtagcccttgtttccatggacacagcctccaggggctcctgatatcgaaaggc
caggccttgataaccaagaactccctgtactggctcagtacccacaagttctgtaaaagc
tattgtaaacatgtgacaacttacgaagaatcaaatttttctttgagttaccagtttata
ctaaacattttctccttcttactgagaataaagacctctgctctccatgaagaagtgagc
ctacttgaaaagaaactttttgaaaaaaagtacaatgaatcaaaaaggagctcaagatcc
aagaaagtgagaagacattga

DBGET integrated database retrieval system