KEGG   Rattus norvegicus (rat): 690460
Entry
690460            CDS       T01003                                 

Definition
(RefSeq) keratin associated protein 10-7-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Keratin_B2_2 PMG
Other DBs
NCBI-GeneID: 690460
NCBI-ProteinID: NP_001103063
RGD: 1596048
Ensembl: ENSRNOG00000042797
UniProt: D3ZUG4
Position
20
AA seq 251 aa
MAASTLSICSSDLSYDSRVCLPGSCDSCTDSSWQVDDCPESCCEPCGCAPSCCQPSCCVP
CCAPSCCVPSCCQASCCAPCLTLICTPVSCVSSPCCQSSSCTPSCCQQSSCQPACCTCSP
CQQPCGVTLCCKPVCCTPICSESCCQQSSCQSSCCQPSCCVPVCCRPVCCTPICSASSSS
CCQPSCCAPVCCKPVCCKPCSSLSLLCSPVCRPACCVPTSSCCASSCQPSCCRPASCVSL
LCRPACSRQAC
NT seq 756 nt   +upstreamnt  +downstreamnt
atggctgcctctaccttgtccatttgctccagtgacttgagctatgacagccgggtctgc
ctgcccggttcctgtgactcttgcactgactcctcctggcaagtggacgactgcccagag
agctgctgtgagccctgtggctgtgcccccagctgctgccagcctagctgctgtgttcct
tgctgtgcccccagttgctgtgtccccagctgttgccaggccagctgctgtgccccctgc
ctgactctcatctgcaccccagtgagctgtgtgtccagcccctgctgccagtcttcctcc
tgcacaccctcatgctgccagcagtctagctgccagccagcttgctgtacctgctccccc
tgccagcagccctgtggtgtgaccctttgctgcaagcctgtctgctgcacacccatctgc
tctgaatcctgctgccagcagtctagctgccagtcctcctgctgccagccctcctgctgt
gtgcctgtctgctgcaggcctgtgtgctgcacacccatctgctctgcctcctcctcctcc
tgctgccagccctcctgctgtgctcctgtgtgctgcaagcctgtgtgctgcaagccctgc
tccagcctgtccctgctgtgcagccctgtgtgcagacctgcctgctgtgtgcccacctcc
tcctgctgtgcctcctcttgccagcccagctgctgtcgcccagcctcctgtgtgtccctg
ctgtgccgccctgcctgctccagacaggcctgctga

DBGET integrated database retrieval system