KEGG   Rattus norvegicus (rat): 690483
Entry
690483            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC690483
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 690483
NCBI-ProteinID: XP_006223296
RGD: 1596028
Ensembl: ENSRNOG00000032990
UniProt: D3Z8D1
Position
1q22
AA seq 369 aa
MLWGLRSLLLLHLGFLSPVLVDTKKTAVEDGLCSTVPCVIEFSKAPLRKPMIVSYRLNEN
ISFHAGTSQPRGPVADLSTEEVEYCILLTHNMLGRKNMTYSLYVGLGAQKDLTQKQELHI
PGSSMAGEPVSLTCTIHSTCQESKALFLSWKGPIMSSSTTVPINPSSALAIDPKPEDQDT
TLRCHLKLSLDNLSSSKVVKLQLVSPARLLNYSCLLKRTLTCSCSFHGIPTPSVQWWVGR
TPVSVNSIDAILHMTSTTLESWTNSTIHLMWEPEIIKSLRCEGKNQYGVHASGIFLIPDK
SSVSSVFLRGLIQGIVYGAIASALFFFFLVVLGMKILNWWEENQTCKNEEAPTLKKPVWG
GAKPAEVGS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgctgtgggggctcagatccctacttctgctgcatttggggttcctttctccagttttg
gttgataccaagaagacagcagtggaagatggtctatgcagtacagtcccttgtgtgatt
gaattttccaaggcgcctctcagaaaacccatgattgtgagctataggcttaatgaaaat
atcagcttccatgctggcaccagccagcccaggggccccgtggctgatctctccacagag
gaggtggaatactgcatcctgctgacccacaacatgctcggaaggaaaaacatgacctac
tcgctctatgtaggtctaggagctcagaaagacctgacccaaaagcaagagcttcacatc
ccaggaagtagtatggctggagagcctgtgtctttgacctgtaccatccacagcacctgc
caagagtccaaagctctttttctctcctggaaaggacccattatgtcttctagcacaact
gtccccatcaacccctcttcagcactggccattgaccccaaacctgaggaccaggacacc
actctcagatgccacttaaagctatccctagataacctgtccagcagtaaagtagtcaag
ctacaactggtctcacctgccaggctgctgaactactcctgtctgctgaagagaacactc
acctgtagctgttccttccatgggatccccacaccttcagtgcagtggtgggtgggaagg
acccctgtgagtgtgaatagcatagatgccatcctgcacatgacctccaccacgctagaa
tcctggaccaacagcaccattcacctcatgtgggagccagaaatcattaagagtcttcgc
tgtgaggggaagaaccaatatggagtccatgcctctggaatcttcttgataccagataag
agctccgtttccagcgtgttcctgagaggactcatccaggggattgtgtatggggccatc
gcatctgctttgttcttcttcttcctcgttgtgctgggaatgaagatacttaattggtgg
gaggaaaatcaaacttgcaagaacgaagaagccccaactctcaagaaaccagtttgggga
ggagccaaaccggctgaagtcggaagctga

DBGET integrated database retrieval system