KEGG   Rattus norvegicus (rat): 690492
Entry
690492            CDS       T01003                                 

Gene name
Cd33
Definition
(RefSeq) CD33 molecule
  KO
K06473  CD33 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    690492 (Cd33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    690492 (Cd33)
   04091 Lectins [BR:rno04091]
    690492 (Cd33)
CD molecules [BR:rno04090]
 Proteins
  690492 (Cd33)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  690492 (Cd33)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2 C2-set_2 C2-set HepII_C
Other DBs
NCBI-GeneID: 690492
NCBI-ProteinID: XP_017445590
RGD: 1596020
Ensembl: ENSRNOG00000037331
Position
1q22
AA seq 298 aa
MLWIVLLLLLCTDSLVQDLEFQLVAPKSVTVEEALCVHVPCSVSYPSIRPTFGPVTGYWL
LKGTSLHEDSPVATNDPRQLVQKATQGRFQLLGDPQKHDCSLLIRDAQKNDTGVYFFRVV
REPFVRYSYRANQLLLHVTPLSRTPDIIIPETLRAGHPSNLSCSVPWACEQGTPPTFSWM
SDALTSLSSRTTNSSVLTLTPRPQDHGTKLTCLVTFSGAGVTVERTIRLNVTWKSDQMRQ
VVLVAVGEAAVKLLILGLCLTLLSVVICRRKATKLSVHMNCENPYQGSPAGLQGAQPC
NT seq 897 nt   +upstreamnt  +downstreamnt
atgctgtggatagtgctactgctcttgctgtgtacagactccctggttcaggatttagaa
ttccagctggtggcgcccaagtcggtgacagtagaggaggccttgtgtgttcatgtgccc
tgcagtgtttcttacccctccattaggcccacttttggacctgtcactggctactggctc
ctgaaagggacgagtctccatgaagattctccagtggccacaaatgaccccagacaacta
gtgcagaaggcaacacagggccgattccaactccttggagacccacagaaacatgactgt
tccctgctcatcagagatgcacagaaaaatgacacaggagtgtacttcttcagagtggtt
agagaaccttttgtgagatattcttacagagcaaaccagctgttgctgcatgtgacccct
ctatcacggactcctgacatcataatcccggaaaccctgagagctggccatcctagcaat
ctgagctgctctgtgccttgggcctgtgagcaggggacaccccctaccttctcctggatg
tcagatgccctcacctccttgagttccagaaccacaaactcctcagtgctgacactcaca
cctcggccccaggaccatggtaccaaactcacctgtctggtgaccttctctggagcaggc
gtcactgtggaaagaaccatccgcctcaatgttacctggaaatcagaccagatgagacag
gtggtcctggtggctgtcggggaggcagcagtcaagctcctgattcttgggctctgtctc
acacttctcagtgtggtgatctgcaggaggaaggcaacaaaactgtcggtgcacatgaac
tgtgaaaatccctaccaaggctcacccgcaggactccaaggtgcacagccatgctga

DBGET integrated database retrieval system