KEGG   Rattus norvegicus (rat): 690585
Entry
690585            CDS       T01003                                 

Gene name
Alyref
Definition
(RefSeq) THO complex subunit 4
  KO
K12881  THO complex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
rno05014  Amyotrophic lateral sclerosis
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    690585 (Alyref)
  09122 Translation
   03013 RNA transport
    690585 (Alyref)
   03015 mRNA surveillance pathway
    690585 (Alyref)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    690585 (Alyref)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    690585 (Alyref)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    690585 (Alyref)
   03041 Spliceosome [BR:rno03041]
    690585 (Alyref)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     690585 (Alyref)
    TREX complex
     690585 (Alyref)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    690585 (Alyref)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    690585 (Alyref)
SSDB
Motif
Pfam: RRM_1 FYTT
Other DBs
NCBI-GeneID: 690585
NCBI-ProteinID: NP_001103072
RGD: 1594679
Ensembl: ENSRNOG00000036687
UniProt: D3ZXH7
Position
10
AA seq 189 aa
MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGAVQAAARVNRGGGPMRNRPA
IARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDA
DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDASYIPPLL
DLLPEDSLL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccgacaaaatggacatgtctttggacgacatcattaagctgaaccggagccagcga
ggaggccgcggcgggggccggggtcgcggcagggccggctcccagggcggccgcggcggc
gcagtgcaggccgccgcgcgggtgaatcgaggcggcgggcctatgaggaaccggcccgcc
atcgcccgcggcgccgcaggcggcggcggcaggaaccgaccggcaccatacagcagaccg
aaacaacttcccgacaagtggcagcacgacctattcgacagcggcttcgggggtggagcc
ggcgtggagacgggtgggaagctgcttgtgtcaaacctggatttcggagtgtcagacgct
gatattcaggaactgtttgccgagtttggaacgttgaaaaaagctgctgtgcactatgat
cgctctggacgaagtttagggacagcagatgtacactttgaacggaaagcagatgccctg
aaggctatgaaacagtacaatggtgtccctttggatgcaagctacatccctcccctcctt
gatctccttccggaagattcacttctgtga

DBGET integrated database retrieval system