KEGG   Rattus norvegicus (rat): 690654Help
Entry
690654            CDS       T01003                                 

Gene name
Wars2
Definition
(RefSeq) tryptophanyl tRNA synthetase 2 (mitochondrial)
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    690654 (Wars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    690654 (Wars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    690654 (Wars2)
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     690654 (Wars2)
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   690654 (Wars2)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    690654 (Wars2)
 Prokaryotic type
    690654 (Wars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b NCD1 dCache_3
Motif
Other DBs
NCBI-GeneID: 690654
NCBI-ProteinID: NP_001162112
RGD: 1593417
Ensembl: ENSRNOG00000019508
UniProt: F1M8H2
Position
2q34
AA seq 360 aa AA seqDB search
MALFSVRKARECWRFIRALHKGPTATAAPQKESGERVFSGIQPTGIPHLGNYLGAIESWV
KLQEEYDTVIYSIVDLHSITVPQDPGILQQSILDMTAVLLACGIDPERSILFQQSQVSEH
TQLSWILTCMVRLPRLQHLHQWKAKAARQKHDGTVGLLTYPVLQAADILCYKSTHVPVGE
DQVQHMELVQDLARSFNQKYGELFPLPRSILTSMKKVKSLRDPSAKMSKSDPDKLATVQI
TDSPEEIVRKFRKAVTDFTSEVTYEPDSRPGVSNMVAIHAAVSGLSVEEVVRNSAGVDTA
RYKLLVADAVIEKFAPIRSEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGIL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgttctccgtgcggaaggcgcgtgagtgctggcgcttcatccgggcacttcat
aaaggacccacagctactgcggctccccagaaggagagcggggagcgagtgttctctggc
attcagcctacaggaatcccccacctgggaaattaccttggagccatcgagagctgggtg
aagttacaggaggagtatgacacggtgatatacagcattgtggacctccactccatcact
gtcccccaagaccccggcatcctgcagcagagcatcctggacatgactgccgtgctcctt
gcctgcggcatagacccagagagaagtatccttttccagcagtctcaggtgtctgaacac
actcagttaagttggatcctcacctgcatggtgagactgcctcgactacagcatttacac
cagtggaaggcgaaggctgcgaggcagaagcatgatgggacagtaggcctgctcacatac
cctgtactccaggcggcagacattctgtgctacaagtccacacacgttcctgtcggggaa
gatcaagtccagcacatggaactagttcaggatctagctcggagtttcaaccagaagtat
ggcgagctctttccactgcccaggtctattctcacatccatgaagaaagtgaaatctctt
cgtgacccttctgccaagatgtcaaaatcggaccctgacaaactggccactgtccaaata
acagacagcccagaggagattgtacggaaattccgcaaggctgtgacggacttcacgtca
gaagtcacctacgagccggacagcagacctggtgtctccaacatggtggcgatccatgcg
gccgtgtcaggcctctcggtggaggaggtggtgcgcaatagtgcaggcgtggacactgca
cgctacaagctgctagtggccgacgctgtgattgagaaatttgctccaatcagaagtgaa
attgaaaaactgaaaatggataaggaccatttaagaaaggttttacttgtgggatctgca
aaagccaaagaattagcctctcctgtgttcgaggaggtgaagaagttggtggggattctg
tag

DBGET integrated database retrieval system