KEGG   Rattus norvegicus (rat): 690743
Entry
690743            CDS       T01003                                 

Gene name
Mlkl
Definition
(RefSeq) mixed lineage kinase domain-like protein
  KO
K08849  mixed lineage kinase domain-like [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04668  TNF signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    690743 (Mlkl)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690743 (Mlkl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    690743 (Mlkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    690743 (Mlkl)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     690743 (Mlkl)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  Other
   690743 (Mlkl)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kinase-like COG7 Voldacs zf-MYND Phage_min_cap2 TBCC_N
Other DBs
NCBI-GeneID: 690743
NCBI-ProteinID: XP_008770792
RGD: 1592221
Ensembl: ENSRNOG00000042353
UniProt: D3ZKP6
Position
19
AA seq 464 aa
MDKLGQIIKLGQLIYDQCEKMKYCKRQCRRLRNRVHGLLQPLQRLQAQEKKSLPSDITAA
LGRFEDVLKEARQQIEKFSQKSNIWKFATVGSDKILFHEVNEKLRDIWEELLLLLQVDQW
KSDSEVSQPASWQQEDQQDAEEDGNENMKVILVKLQISMEEIKEALKQCSLKPMQEVPQD
FQVKEIPKEDLGYPWTKLKTNKLSTIYRGEYYKSPVTIKVFNNPKAESVGIVRLTFNEEI
KTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDRDKDLTMSVRSLLVL
RAARGLYRLHHSGTLHGNISSSSFLVAGGYQVKLAGFELSKTQTSISRATKSTKAERFSS
TAYVSPERLQDPFCKYDTKAEIYSFGIVLWEIATGKIPFEGCDSEKIYELVAENKKQEPV
GQDCPELLQEIINECRAHEPSNRPSADGILERLPAIEDSMDKKL
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggataaattgggacagatcatcaagttaggccagctcatctatgaccagtgtgaaaag
atgaaatactgcaaaagacagtgccggcgtctaagaaaccgtgtgcatggcctgctacag
cctctccagaggctccaggcccaagaaaagaagagcctccccagtgacattactgctgcc
ctgggccgttttgaggacgtcctaaaagaagctagacagcagatagaaaagttcagtcag
aagtccaatatttggaagtttgctactgtgggcagtgataagatcctcttccatgaagtg
aatgagaagctgagagacatctgggaggagctcttgctgctgcttcaggttgatcaatgg
aagtctgattccgaggtcagccaaccagcatcctggcagcaggaagatcaacaggacgca
gaggaagatggaaatgaaaatatgaaagttattttggtgaagctgcaaatcagcatggaa
gaaatcaaagaggccctgaagcaatgctcactaaaacccatgcaggaggtcccacaagat
ttccaagtcaaggagattccgaaggaagatcttggatatccgtggaccaaactgaagaca
aataaactgagcacgatttatagaggagagtattacaaatctccagtcaccatcaaagta
ttcaacaaccccaaggccgaaagtgttggaatagtgaggctcactttcaatgaggagatc
aaaaccatgaagaaatttgattctcccaacatcctgcgtatatttgggatttgcatcgat
caaacagtgaagccccccgaattctccattgtcatggagtactgtgaactcggaaccctg
agggaactgctggatagagacaaggacctcaccatgagtgtgcgcagcctcctagtcctg
agggcagctagaggcttgtacaggttacaccactcgggaacactccacggaaacatcagc
agctccagcttcctggtagctggaggctaccaagtaaagcttgcaggatttgagctaagc
aaaacacagacttctataagccgggcaacaaagagcactaaagcagagagattcagttcg
acagcatatgtctcccccgagagactgcaagatccattttgcaaatatgacacaaaagct
gaaatatatagctttggaattgtgctctgggaaattgccactggaaagatcccgtttgaa
ggctgtgattctgagaagatctatgagctggtggctgagaacaagaagcaggagccagtg
ggtcaggattgccccgagttgttgcaggagatcattaatgagtgccgggcccatgaaccc
tccaatcggccctctgcggatggaatcttggagagactgcctgccattgaagactccatg
gacaaaaagctgtaa

DBGET integrated database retrieval system