KEGG   Rattus norvegicus (rat): 690853Help
Entry
690853            CDS       T01003                                 

Gene name
Aatk
Definition
(RefSeq) apoptosis-associated tyrosine kinase
  KO
K17480  lemur tyrosine kinase 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    690853 (Aatk)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    690853 (Aatk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     690853 (Aatk)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  LMR family [OT]
   690853 (Aatk)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     690853 (Aatk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 690853
NCBI-ProteinID: NP_001162174
RGD: 1590980
Ensembl: ENSRNOG00000004392
UniProt: D4ABZ3
Position
10q32.3
AA seq 1370 aa AA seqDB search
MPIALLALAMSSSFFNPSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVIVLMLA
CLCCKKGGIGFKEFENAEGEEYVADFSEQGSPAATVQNGPDVYVLPLTEVSLPMAKQPGR
SVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKASASVQEQMQF
LEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTL
QRMACEVACGVLHLHRHNYVHSDLALRNCLLTADLTVKVGDYGLAHCKYREDYLVTADQL
WVPLRWIAPELVDEVHGNLLVVDQTKTSNVWSLGVTIWELFELGAQPYPQHSDRQVLAYA
VREQQLKLPKPQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEF
ERRWRSLRPGGSAGLGSASTVPAAAASELTAASSFPLLEQFTSDGFHVDSDDVLTVTETS
HGLNFEYKWEAGCGAEAYPPPGAAFSPGSAGRLQELCAPDSSPPGVVPVLSAHSPSVGSE
YFIRLEGAVPAAGHDPDCAGCAPSPQAVSEQDNNSEESTAASLVMEPLLGHAPPTGGLWG
PCDHHSRRRQEPPCPSRSPSPGTPMLPAEDIDWGVATFCPPFFDDPLGTSPSGSPGAQPS
PSDEELEEGKTGRAAQCGHWSSNMSANNNSGSRDPESWDPGYVSSFTDSYRDDCSSLEQT
PRASPELGHPLSQEDSRDFLPGLVAASPGQESSRCFNLLPLCPAKGLAPAACLVPPPWTE
AAVGGAENPIVEPKLAQEAEGSAEPQLPLPSVPSPSHEGASLPSEEASAPDIQPASPTPA
AGSWVTVPEPAPTLDSSSSSLGQEVPSSEDEDTTEVTSGVFTDLSSDGPHTEKSGIVPAL
RCLQKQVGTPDSLDSLDIPSSASDGGCEVLSPSAAGPAGGQPRAMDSGYDTENYESPEFV
LKEAHESSEPEAFGEPASEGESPGPDTLLSVSLGDLSRKNPYRDSAYFSDLDAESEPNFG
PEKHSGIQDSQKEQDLRSPPSPGHESVQAFPRPEVSSEVLPPPQQSEEPMPEGPGSEPLE
AQGPVEVEPVPGPSHSKCLLLTSAPLSSEGNGTESRGPPGPLSGPAQTGRMGNPSTSRSP
LCLALPGHPGTSEGRPEDDEDTEDSEESDEELRCYSVQEPSEDSEEEPSAVPVVVAESQS
ARNLRSLLKMPSLLSEAFCDDLERKKKAVSFFDDVTVYLFDQESPTREAGEPFPSTKECP
TFLEGSPGSPSATGVPLRAGHSPDSSAPEPGSRFEWDGDFPLVPGKAALVTALDPADPVL
AAPPTPAAPFSRFTVSPAPPSRFSITQVSDSDAQSMGGPAADAEGRCTKA
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgcgctgctggccctggccatgtcgtcgtccttcttcaaccccagctttgcc
ttcagctcccacttcgacccggacggtgccccgctcagtgagctatcctggtcctcgtcc
cttgcagtggttgctgtgtccttctctgggatcttcactgtcattgtcctcatgctggcc
tgcctgtgctgtaagaagggcggcattgggttcaaggagtttgagaatgctgaaggggaa
gagtatgtggccgacttctcggagcagggctccccggctgctactgtacagaacggcccc
gatgtgtatgtcctgcctctcactgaggtctccctgcccatggctaagcagccgggtcgc
tcagtgcaactcctcaagtccacggacctgggccgccacagcctcctgtacttgaaggag
attggccacggttggtttgggaaggtgttcttgggggaggtgcactcgggtgtcagtggc
acgcaggtggtggtgaaggagctgaaggccagcgccagtgtgcaggagcagatgcagttc
ctggaggaggcgcagccctacagggccctgcagcacagcaacctgcttcagtgcctggcc
cagtgtgctgaggtgaccccctatttgctggttatggagttctgtcccctgggggacctc
aaaggttatctacggagctgccgggtgacagagtccatggcgcctgacccccttaccttg
cagcgcatggcgtgcgaggtggcgtgtggtgtcttgcatctacatcgtcacaactatgtg
cacagtgacctggccctgaggaactgcctgctgacggctgacctgacagtgaaggttggc
gactatggcctggcccattgcaaatacagggaagactacctcgtgacggccgaccagttg
tgggtgccgctgcgttggatcgcgccagagctggtggatgaggtgcatggcaacctactg
gtggtggaccagactaagaccagcaatgtgtggtccctgggtgtgaccatctgggagctt
ttcgagttgggcgcgcagccctacccccagcactcggaccggcaggtgctggcttacgcc
gtccgagaacagcaacttaagttgcccaagccccagctacagctgactctgtctgatcga
tggtacgaggtgatgcagttctgctggcttcagccagaacagaggcctacggctgaggag
gttcatctgctgctgtcctacttgtgcgccaagggcaccacggagctggaggaggagttc
gagcggcgctggcgctccctgcggccggggggcagcgcggggctgggctcagcttccaca
gtcccggcagctgccgcatctgaactcactgctgcttcatctttcccgctgctggagcag
ttcaccagtgacggcttccacgtggacagcgacgacgtgctgacagtcactgagacgagc
cacggcctcaacttcgaatacaagtgggaggctggctgtggcgctgaggcttacccgccc
ccaggcgctgctttcagcccaggttccgcagggcgcctgcaggagctgtgtgcacccgac
agctcgccgccgggtgtggtgccggtcctcagtgcccacagcccctcagtgggtagcgag
tacttcatccgcctggagggggcagtgccggctgctggccatgacccagactgtgccggc
tgtgctcccagcccccaagctgtgtccgagcaggacaataactctgaggagagcaccgct
gcatcccttgtcatggagccgcttctgggccacgcaccacccactgggggcctgtggggc
ccctgcgaccatcattctcgaaggaggcaagagccaccctgcccctcacgctcaccctct
cctgggaccccgatgttgccagctgaagacatagactggggtgtagctaccttctgccca
cccttttttgatgacccactgggcacatctccctctgggagtcctggggcccagccatcc
cccagtgatgaggagctggaggagggaaagactgggagggctgctcagtgtggacactgg
agctctaacatgtctgccaacaataacagtggcagtcgagacccagaatcctgggatcct
ggctatgtgagcagcttcacagacagctacagggacgactgctccagcttagagcagacc
cctcgggcctcccctgagctgggccatcccctgtcccaggaggattccagagatttttta
cctgggctagtagcagcttcccctggccaggagtcaagccgttgcttcaacctgctccct
ctgtgtcctgccaaaggcctggcacctgctgcttgcctcgtcccacccccctggacagag
gcagctgtaggtggggctgagaaccccattgtcgaacccaaacttgcccaggaggctgag
ggctctgctgaaccccagctaccccttccttctgtcccctccccatcccacgaaggagcc
tcgcttccctcggaggaggcaagcgctcctgacatccagcctgcctctcctacacccgct
gctggcagctgggtgaccgtccctgagccagcccccaccctggatagcagcagcagttct
ctggggcaagaggtacccagcagcgaggatgaagacacaaccgaggttacgtcaggagtc
ttcaccgacctgtccagcgacggcccacacacggagaagtcaggcatagtaccagccttg
cgctgtctgcagaagcaggtggggacccctgactccctggactctttggacatcccgtcc
tcagccagcgatggcggctgtgaggtcttaagcccatcagctgctggccccgctggtggg
cagccccgtgccatggacagtggctatgatacagagaactatgagtcccctgagtttgtg
ctcaaggaggcccatgagtcaagtgagcctgaggcctttggggagccagcctcagagggt
gagagcccagggcccgatactctgctctctgtctcccttggtgacctcagcagaaagaac
ccctaccgagactctgcctacttttcagacctggatgctgagtccgaacccaactttggc
cctgagaagcacagtgggatccaggactcccaaaaggagcaagacctgaggagcccacct
agtccagggcatgagtctgtgcaggcttttcccaggcctgaggtgtccagcgaggtgctg
ccccctccacagcagtcagaggagcccatgccagaaggccccgggtcagagcctcttgag
gctcaaggcccagttgaagtggagcccgtgccaggcccaagtcattccaaatgtctcctg
ttgacctccgctccactgagctcggaaggcaatggcacggagtcccggggtcccccagga
ccactgtcagggccagcccagaccgggcggatggggaatcctagcacatccagatccccg
ctctgcctggccctgcctggccaccctgggacttcagagggacggccagaggatgacgag
gacaccgaggacagtgaggagtctgacgaggagctccggtgctacagcgtccaggagccc
agtgaggacagtgaggaggagccatcagcggtgcctgtggtagtggctgagagccagagt
gcccggaatctacgcagcctgctgaagatgcccagcctgctgtcggaggccttctgcgac
gacctggagcgcaagaagaaggctgtgtccttctttgatgacgtcacggtctacctcttt
gaccaggagagccccacccgagaagctggggagcccttccccagcacgaaggagtgtccc
acgttcctggagggtagccccggctcacccagtgccactggcgtgccactgcgggctggt
cactcgccagacagctctgctcccgaaccgggcagtaggttcgaatgggatggagatttc
ccactggtgccgggcaaggctgctttggtgactgcgctggatcctgccgaccctgtcctg
gctgcgcctcccacgccagctgcaccattttcacgcttcacggtgtcgcccgcacctccc
tcccgcttttccatcacacaagtatccgactcagatgcccagtccatgggaggcccggca
gcagatgctgagggccgatgcacaaaggcttga

DBGET integrated database retrieval system