KEGG   Rattus norvegicus (rat): 690871Help
Entry
690871            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC690871
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH CX9C
Motif
Other DBs
NCBI-GeneID: 690871
NCBI-ProteinID: NP_001182411
RGD: 1590963
Ensembl: ENSRNOG00000042653
UniProt: D3ZUI9
Position
10q32.3
AA seq 74 aa AA seqDB search
MSVNGAVWGRVRSRLRAFPEHLAACGAEASAYGKCVQASTAPGGRLSKDLCVREFEALRS
CFAAAAKKTMMGGS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcaacggagcggtgtgggggcgtgtgcggagccgtctccgagcctttcccgag
catctggcggcctgcggagctgaggcctcggcgtatgggaagtgcgtgcaggcctccact
gccccaggaggccgcctgagtaaggacctgtgcgtgcgcgagttcgaggccctgcggagc
tgcttcgccgccgcggccaagaagaccatgatgggaggctcctag

DBGET integrated database retrieval system