KEGG   Rattus norvegicus (rat): 690899Help
Entry
690899            CDS       T01003                                 

Gene name
Vsir
Definition
(RefSeq) V-set immunoregulatory receptor
  KO
K23268  V-type immunoglobulin domain-containing suppressor of T-cell activation
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    690899 (Vsir)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 690899
NCBI-ProteinID: NP_001037765
RGD: 1590938
Ensembl: ENSRNOG00000000569
UniProt: G3V9P3
Position
20q11
AA seq 309 aa AA seqDB search
MGVPTVPEASSLRWGTLLLTIFLAASRGLVAAIKVTTPYSLYVCPEGQNVTLTCRILDSV
SKGHDANFLKTWFLSSRGEVQVCKEHRPIRNFISHHQHHRSHPAVNASHDQPQKHGLEIA
YDNHGNFSITLHNVTLSDSGLYCCLVIEVKHHHPERRLYGYMELQVQTGKGSASTCTAYP
PNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQAASHRRAQELVRMDSNTQGIEN
PGYETTPPFQGMPEAKTRPPLSYVAQRQPSESGRHLLSDPSTPLSPPGPGDVFFPSLDPV
PDSPNSEAI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccccacggtcccagaggccagtagtctgcgctggggaaccctgctcctcact
atttttctggctgcatccagaggtctggtagcagccatcaaggtcaccactccatattct
ctgtatgtgtgtccagaggggcagaatgtcaccctcacctgcaggattctggactccgta
tccaaagggcacgatgcaaacttcttaaagacgtggttccttagctctcgaggcgaggtt
caagtgtgcaaagaacacaggcccatacgtaacttcatatcacaccatcaacaccacaga
agtcacccggcagtcaatgccagccatgaccagccccagaaacatgggctggagatagct
tatgacaaccacggtaacttctctatcaccctgcacaatgtgaccctaagcgacagcggc
ctctactgctgtctggtgatagaagtcaaacaccaccacccagaacggcggctctacggg
tacatggagctgcaggtacagacaggcaaaggctcagcatctacatgcacagcgtacccg
cctaatgagcaggacagtgacagcatcacggctgcggccctggccacgggcgcctgcatt
gtcggaattctctgccttccccttatcctgttgctggtctataagcagaggcaggcggcc
tctcaccgccgtgcccaggagctggtgaggatggacagcaacacccaaggaatcgaaaac
ccaggctatgagaccactccacccttccaggggatgccggaggccaagactaggcctcca
ctgtcctatgtggcccagcggcaaccttccgagtcgggacggcacctgctgtctgacccc
agcacacctctgtcccctccaggccctggggatgtcttcttcccatccctggatccagtc
cctgactcccctaactctgaagccatctaa

DBGET integrated database retrieval system