KEGG   Rattus norvegicus (rat): 690945
Entry
690945            CDS       T01003                                 

Gene name
Dera, Dera-ps1
Definition
(RefSeq) deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00030  Pentose phosphate pathway
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    690945 (Dera)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     690945 (Dera)
SSDB
Motif
Pfam: DeoC DUF5744 Sin3_corepress
Other DBs
NCBI-GeneID: 690945
NCBI-ProteinID: XP_003749910
RGD: 1589836
Ensembl: ENSRNOG00000007570
UniProt: F1M1H0
Position
4q44
AA seq 318 aa
MAAHCRGTELDLSWVSRVQVNHAAVLRRAEQIQARRSVKKEWQAAWLLKAVTFIDLTTLS
GDDTFSNVQRLCYKAKYPIRADLLKALNMHDEGITTAAVCVYPARVCDAVKALKAAGCRI
PVASVATGFPAGQTHLKTRLEEVRLAVEDGATEIDVVINRTLVLTGQWEALYDEITQFRK
ACGEAHLKTILATGELGSLTNIYKASLVAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKVGFKPAGGIRTAKESLVWLSLVKEELGDEWLTPDLFRIGASSLLSDIERQ
IYHHVTGRYAAYHDLPMS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggctgctcactgccggggcacagagctcgatctcagctgggtctccagagttcaagtg
aaccatgcggctgtgctgaggcgggccgagcagatccaggcccgccgaagtgtgaagaag
gaatggcaggctgcgtggctcctgaaagctgtcacgttcatagacctcaccacgctttct
ggtgatgacacgttttccaacgttcaacggctctgttataaagccaaatatccaatccgg
gcagacctcttaaaagccttaaatatgcatgacgaaggtatcaccacggctgcggtctgt
gtttaccctgcccgggtctgcgatgctgtgaaggcactgaaggccgcaggctgcaggatc
cctgtggcatcagtggccactggctttccagctggacagactcatttaaagactcgattg
gaagaggtcagactggcagtggaggacggagctactgaaatcgacgtggtcattaacagg
accttggtgctgactggccagtgggaagctctctacgatgagatcactcagtttcgaaag
gcctgtggggaggcccatctcaaaaccatcttggctacgggagagctcggctctctcacc
aacatctacaaagccagcctggtagcaatgatggcgggatcagattttattaagacctct
actggaaaagaaacagtaaacgccaccttcccggtagccatcgtgatgctgcgggccatt
agagatttcttctggaaaactggaaacaaggtaggctttaagcctgcaggaggcatccgt
acagcgaaggaatcccttgtgtggctctctctggtaaaggaggaactgggggatgagtgg
ctgactcccgacctcttccggataggggccagctctctgctctccgacatcgagagacag
atttaccatcacgtgactggacgatatgcggcttatcacgatcttccaatgtcttag

DBGET integrated database retrieval system