KEGG   Rattus norvegicus (rat): 690966
Entry
690966            CDS       T01003                                 

Gene name
Polr2e
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC1
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    690966 (Polr2e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    690966 (Polr2e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    690966 (Polr2e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    690966 (Polr2e)
   03400 DNA repair and recombination proteins [BR:rno03400]
    690966 (Polr2e)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     690966 (Polr2e)
  RNA polymerase III system
   RNA polymerase III
     690966 (Polr2e)
  RNA polymerase I system
   RNA polymerase I
     690966 (Polr2e)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      690966 (Polr2e)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 690966
NCBI-ProteinID: NP_001103084
RGD: 1589817
Ensembl: ENSRNOG00000013545
UniProt: B0BNE2
Position
7
AA seq 210 aa
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atggacgacgaggaggaaacgtatcggctgtggaagatccgcaagactatcatgcagctg
tgtcatgaccgaggctacctggtgacccaggatgagctggaccagacacttgaagagttc
aaggcacagtttggggacaagcccagcgaaggacggccgaggcgcacagacctcaccgtg
ctggtggcccacaacgatgatcccacagaccagatgtttgtcttcttcccagaggagccc
aaggtgggcatcaagaccatcaaggtgtactgccagcgcatgcaggaggagaacatcaca
cgggcgctgatcgtggtgcagcagggcatgacaccctccgccaagcagtccctggtagac
atggcccctaagtacgtgctagaacagtttctacagcaggagctgctcatcaatatcaca
gaacatgagctagtccctgagcacgtggtcatgaccaaggaggaggtgacggaactgctg
gcgcgatacaagctccgtgagagccagctgcccaggatccaggctggggacccggtggca
cggtacttcgggatcaagcgagggcaggttgtgaagattatccgccccagtgagacagcc
ggccggtacatcacctaccgcctggtgcagtag

DBGET integrated database retrieval system