KEGG   Rattus norvegicus (rat): 691014Help
Entry
691014            CDS       T01003                                 

Gene name
Dppa3l1
Definition
(RefSeq) developmental pluripotency associated 3-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PGC7_Stella SPEG_u2
Motif
Other DBs
NCBI-GeneID: 691014
NCBI-ProteinID: XP_001076514
RGD: 1588677
Ensembl: ENSRNOG00000022376
UniProt: D4A0W6
Position
8q24
AA seq 150 aa AA seqDB search
MEEPSEKVNPVVDPETPQMKDEEGSSDDSEVPQPETLVQVMKTLTLNPSANQSAHRLSLR
HRIGSSPVENGSERILREVQSAFPKRKVRTLLLVLKDPTARMRRFVQIEQRQKRLEGNEY
KWNTEPFRCPCTFCHYQRWDPSENAKTRKN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccatcagagaaagtcaacccagttgtggacccagaaactcctcagatgaaa
gacgaagagggctcatcagatgattcagaagtcccacaaccagaaacactagtacaggtc
atgaaaacgctaaccctgaaccccagtgccaatcagtcagcacatcgtctcagcctccgt
caccggattgggagcagccctgtggagaacggaagtgaaagaatcttgagggaagttcaa
agcgccttccccaagagaaaggtccgcaccttgctgttggtgttaaaagatcctacagca
aggatgagaagatttgttcagattgagcagagacaaaaaaggcttgaaggaaatgagtat
aaatggaacactgagccattcagatgtccctgcactttctgccactatcagagatgggat
ccttctgagaatgctaaaaccaggaagaattag

DBGET integrated database retrieval system