KEGG   Rattus norvegicus (rat): 691018Help
Entry
691018            CDS       T01003                                 

Gene name
Hsd17b14, Dhrs10
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 14
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD DUF1776 Glyco_transf_28 NmrA Polysacc_synt_2 RNA_pol_Rpb1_4
Motif
Other DBs
NCBI-GeneID: 691018
NCBI-ProteinID: NP_001178040
RGD: 1588673
Ensembl: ENSRNOG00000020949
UniProt: D4A4Y2
Position
1q22
AA seq 270 aa AA seqDB search
MAAVGRYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRAVEQELLGTVFIP
GDVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYT
LIKLALPHLRKSKGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVN
CISPGNIWTPLWQELAAATSDPRATILEGTLAQPLGRMGQPAEVGAAAVFLASEATFCTG
LELFMTGGAELGYGRKASSSTLVEVPILPP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtaggccgatattctgggaaggtggtggtggtgactgggggcagtcggggc
atcggggctgcgatcgtgagagccttcgtggacagtggggctcaagtggttttctgtgac
aaggatgaggctgggggccgggctgtggagcaggaactcttgggcactgtcttcatcccc
ggtgacgtgactcaggaaggagatttacagactctgatttctgagactgtctctcgattt
ggtcacctggattgtgtggtgaataatgccggctaccacccacctgcacagttgccagag
gagacctctgcccagggcttccgccagctgctggaggagaacctcctgggggcatacacc
ttgatcaagcttgccctcccccaccttcggaagagtaaaggaaatatcatcaacatctcc
agcctggtcggggccatcggccagtcccaggcactaacctatgtggccaccaagggggca
gtgactgccatgaccaaagctttggccttggatgagagtcgatatggtgtccgtgtcaac
tgcatctccccaggaaacatctggactccactgtggcaagagcttgcggctgcaacttca
gaccccagggccaccattctagaaggcaccttggcccagcccctgggccgcatgggccag
ccagccgaggtgggggccgcagccgtgtttctggcctctgaagccaccttctgcacaggg
cttgagctttttatgactgggggtgcagaactgggctatggacgcaaggctagtagcagc
actctcgtggaagtccccattctcccaccataa

DBGET integrated database retrieval system