KEGG   Rattus norvegicus (rat): 691031
Entry
691031            CDS       T01003                                 

Gene name
Cdc42se2, RGD1563924
Definition
(RefSeq) CDC42 small effector 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: PBD
Other DBs
NCBI-GeneID: 691031
NCBI-ProteinID: NP_001119561
RGD: 1563924
Ensembl: ENSRNOG00000042449
UniProt: V9GZ87
Position
10q22
AA seq 84 aa
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM
QSKGGYGGGMPANVQMQLVDTKAG
NT seq 255 nt   +upstreamnt  +downstreamnt
atgagtgaattctggctgtgcttcaactgctgtattgcagagcagcctcagcctaagagg
cgacgacggattgaccgaagtatgattggggaaccaaccaactttgtgcacacagctcac
gtaggatccggagacctatttagtgggatgaactcggtcagctccattcagaaccagatg
cagtccaagggaggttatggaggaggaatgcctgccaatgtgcagatgcagcttgtggac
acaaaggcaggatag

DBGET integrated database retrieval system