KEGG   Rattus norvegicus (rat): 691083Help
Entry
691083            CDS       T01003                                 

Gene name
RGD1306990
Definition
(RefSeq) hypothetical protein LOC691083
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-GeneID: 691083
NCBI-ProteinID: NP_001138334
RGD: 1588621
Ensembl: ENSRNOG00000013437
UniProt: D4AEL0
Position
3q33
AA seq 199 aa AA seqDB search
MIPWARRLLPRNAAGSLSTSSASQQAEDHHRQLEAYRYFLPIQTRWQDNDQYGHVNNAVY
YSYFDTIINHYLLRYCGLETSLLISPLVGFMVTNQCKYHTPIGFPQVPLAALAVEKVGRS
SVCYRLALFPPKPTMELPSVNHHDLIDGFFFGHPKLAQFDTLACTTGSSVHVFVNPATSK
PESLPEDFRNSLQKLMSAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattccttgggcacggaggcttcttcctagaaacgccgctggttccttatctacatca
tcagccagtcagcaagccgaggatcaccaccggcagctggaggcctatcggtacttcctg
cccatccagacccggtggcaggacaacgaccagtatggccacgtgaacaatgccgtgtac
tacagctacttcgacactattatcaaccactacctgctgaggtactgtggcctggaaacc
agcttgctgatatcccccctggtgggcttcatggtgaccaatcagtgcaaataccataca
cccatcggcttccctcaggtcccactggctgccctggctgtggagaaagtgggtcgctcc
agtgtatgttaccgactggctctgtttcctcctaaacccaccatggagctgccttcagta
aatcaccatgatctcattgatggttttttctttggccaccctaaactagcacagtttgac
actctggcctgtaccacggggtcttcagtccacgtctttgtgaacccagccactagcaaa
ccagagagccttccagaagacttcaggaacagtctgcagaagctgatgagtgcagcatag

DBGET integrated database retrieval system