KEGG   Rattus norvegicus (rat): 691209Help
Entry
691209            CDS       T01003                                 

Gene name
Slc12a6, Kcc3
Definition
(RefSeq) solute carrier family 12, member 6
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    691209 (Slc12a6)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   691209 (Slc12a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12
Motif
Other DBs
NCBI-GeneID: 691209
NCBI-ProteinID: NP_001103100
RGD: 1311335
Ensembl: ENSRNOG00000005196
UniProt: G3V6N7
Position
3q35
AA seq 1150 aa AA seqDB search
MHPPETTTKMSSVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPM
SELSGATTSLATVALDPSSDRTSNPQDVTEDPNQNSITGEHSQLLDDGHKKARNAYLNNS
NYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPT
KSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSA
IATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAA
IFRSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYA
GAIKSSFAPPHFPVCMLGNRTLSSRHLDICSKTKEVNNMTIPSKLWGFFCNSSQFFNATC
DEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGNLNHEYVLAD
ITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGA
CIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAK
DNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLA
CALQTLLRTPHWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFA
SQLKAGKGLTIVGSVIVGNFLENYGDALAAEQTIKHLMEAEKVKGFCQLVVAAKLKEGIS
HLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNVSFFP
SNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDL
ATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKD
RNSMLRLTSIGSDEDEETETYQEKVHMTWTKDKYMASRGQKVKSMEGFQDLLNMRPDQSN
VRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRG
GGSEVITIYS
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctccagaaaccaccaccaagatgtcttcagttcggttcatggtgacaccaaca
aagattgatgacattccaggtttatcagacaccagtccggacctcagctctcgatctagt
tctcgagtaagatttagctcccgagaaagtgtgccagaaacaagccgtagtgagcctatg
agtgaactgtctggggccaccacttctctggcaactgttgccctagatccttccagtgac
cggacttctaacccccaggatgttaccgaggacccgaatcagaactccatcacaggggag
cacagccagctgttagatgatggacataagaaagctcgaaatgcttatctcaataattcc
aactatgaagaaggagacgaatattttgataaaaatctggcactctttgaggaagaaatg
gacaccagaccaaaggtgtcttctctcctcaaccgcatggccaactatacaaatctgaca
caaggagcaaaggaacatgaagaggcagagaacatcaccgaagggaaaaagaagcctacc
aagagcccccaaatgggtactttcatgggtgtctacctcccatgtctacaaaatattttt
ggagtgatcctctttctgcgtcttacctgggtagtgggcacagctggagtccttcaggcc
tttgccattgtccttatctgctgctgctgtacaatgttaactgccatctccatgagtgcc
atcgccactaacggagtggtgccagctggaggctcatacttcatgatttcccgggccctg
ggcccagagtttggcggggctgtgggcctctgcttttatcttggcaccacatttgcagca
gccatgtatattcttggtgccattgaaatctttctggtgtatattgtcccccgagctgcc
atctttcggagcgatgatgcactcaaggagtcagcagccatgctgaacaacatgcgtgtc
tatggtacagccttcctggtcctcatggtcttggtggtgttcatcggcgtacgctatgtg
aataagtttgcctcacttttcctggcctgtgtaattgtgtcgatcttggctatctatgct
ggtgccatcaagtcttcctttgctccaccacacttcccggtctgtatgctgggcaaccgc
accctgtcatcaagacaccttgacatttgctctaagaccaaggaagttaacaacatgaca
ataccatcaaagttatggggattcttctgcaactcaagtcagttttttaatgccacctgt
gatgagtactttgttcacaataatgtcacctcaatccagggcattccagggttggctagt
ggcatcattactgaaaacctttggagtaattatttaccaaaaggtgagataattgaaaag
ccatcagccaagtcatctgacgttttgggcaacttaaaccatgaatatgttcttgctgat
attaccacctccttcactcttctggtggggatcttctttccttctgtcacaggtatcatg
gctgggtcaaacagatctggagatctgaaagatgctcaaaagtctatccccattgggacc
atccttgccatcctgaccacatccttcgtgtatttaagcaatgttgtcctttttggtgca
tgtatcgaaggagttgtcctcagagacaaatttggggatgctgtaaaagggaatttggtt
gtaggcaccttatcctggccatccccatgggtgattgttattggctccttcttttcaacg
tgtggagctggacttcagagcctcacaggtgcacctcggctgctgcaggctattgccaag
gacaacatcatacctttccttagggtttttggacacagtaaagctaatggggaacctacc
tgggccttacttctaactgctgccatagcagagctgggaattctcatcgcctccctggat
ctcgtggccccaattctttccatgttttttctcatgtgttacctctttgtgaacttggct
tgtgccttgcaaacattactgcgaaccccccactggaggcctcgattccgctactatcac
tgggccctctctttcatgggaatgagtatctgtctagctctgatgttcatttcttcttgg
tattatgccattgtagctatggtaatagctggcatgatctacaagtacattgaataccaa
ggggctgaaaaagaatggggcgatggtatccgtgggctgtcactcagtgcagcccgcttc
gctttgctccgcctagaggaaggccctcctcacactaaaaactggaggcctcagctgctt
gtactgctaaagctggatgaagacttacacgtcaagcaccctcgcctcctcacctttgcc
tcacagctcaaggcaggaaagggactcaccattgtgggctctgtcatcgtggggaacttc
ctggagaactatggtgacgctctagcagcagagcagaccattaagcacctcatggaggca
gaaaaggtaaaagggttctgccagctggtagtggctgccaagctgaaagagggcatttca
cacctcatccagtcctgtggccttggaggcatgaagcacaacacagtggtgatgggctgg
cccaatggctggcgtcagagtgaagatgctcgtgcttggaagactttcattggcacagtt
cgagtgacaactgctgcccatctagccctgttagtggctaaaaatgtctccttctttccc
agcaatgtggaacaattttctgagggcaacattgatgtgtggtggattgtgcatgatggg
ggcatgctcatgctattaccattcctactgaaacagcacaaggtttggcgaaaatgcagc
atacggatcttcacagtagcccaactagaagacaacagtatccagatgaagaaggacctg
gccaccttcctgtaccatctgcgcatcgaggccgaagtggaagtggtggagatgcatgac
agtgacatatctgcctatacttatgagcgcaccctgatgatggagcagaggtcccagatg
cttcggcacatgcggctgtccaaaacagaacgagatagagaggcacaactggtgaaagat
cgaaactcaatgcttcgcttaactagcattggctctgacgaggatgaagaaacagaaact
taccaagagaaggtgcacatgacttggaccaaggataaatacatggcatcccgggggcaa
aaggtcaaatcaatggaaggattccaagacctacttaatatgcgtccggaccagtccaac
gtgagacggatgcatacagcagtgaagctcaatgaagttatagttaacaagtcccacgaa
gcaaagctggttttgttgaatatgccaggaccaccccgaaaccctgaaggtgatgagaac
tacatggaatttctagaagtgctcactgagggattagagcgagtcctcctcgtccggggt
ggtggcagtgaagtcatcaccatatactcatag

DBGET integrated database retrieval system